BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30507 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 5.7 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 10.0 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 10.0 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 10.0 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -3 Query: 229 DNDDGSPLCSPRRCPANAFPLYRWIRQRRGYP 134 D G+P+C N L +W + G+P Sbjct: 324 DRMQGNPICVQIPWDKNVEALAKWANGQTGFP 355 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 4.3 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +3 Query: 333 GLPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRP 461 G G+ G H G +G +G + P SG P P P Sbjct: 1821 GSQYGQYGAPYDHYGSRGSVGRRSVGSARNIPVSGSPEPPPPP 1863 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 297 DPLPEG*RWNASGLPAGEEG 356 DP P + AS + AGEEG Sbjct: 589 DPXPNTCKVIASSVSAGEEG 608 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 397 LFGSEDECTTQGLD 438 +FGS +EC LD Sbjct: 107 IFGSSEECVALDLD 120 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +3 Query: 414 RMHHPGSGRPRPALRP 461 + HHP RPR P Sbjct: 153 KRHHPRYKRPRTTFEP 168 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 397 LFGSEDECTTQGLD 438 +FGS +EC LD Sbjct: 75 IFGSSEECVALDLD 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,145 Number of Sequences: 438 Number of extensions: 3224 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -