BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30493 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0050 + 19631164-19631987,19632103-19634023 28 5.1 11_08_0064 - 28127955-28128860 27 8.9 11_01_0080 - 619886-619979,620298-620815 27 8.9 >11_06_0050 + 19631164-19631987,19632103-19634023 Length = 914 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 217 YNQIIFHSNIKCLPREIS 270 +NQIIFHS KC P +S Sbjct: 336 FNQIIFHSEDKCHPYHLS 353 >11_08_0064 - 28127955-28128860 Length = 301 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 497 LTAVLLFLPESVTASGKTSRMVV 429 L AV++FLP TA+GKT ++ V Sbjct: 14 LVAVVVFLPCLATATGKTGQIAV 36 >11_01_0080 - 619886-619979,620298-620815 Length = 203 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -1 Query: 486 PTLFAGKRY---CVRQNEQDGGTYPRGLTRHPTTSSYCY 379 P L K Y V N++ Y L HPTTS++C+ Sbjct: 83 PNLNCSKGYDAMAVSINQEPDCLYVLNLRHHPTTSNHCF 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,522,175 Number of Sequences: 37544 Number of extensions: 204698 Number of successful extensions: 406 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -