BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30493 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 25 1.1 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 2.6 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 25.4 bits (53), Expect = 1.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 450 QNEQDGGTYPRGLTRHPTTSSY 385 Q +Q GG YPRG R+ + Y Sbjct: 254 QYDQRGGNYPRGTERNRNGNGY 275 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 488 VLLFLPESVTASGKTSRMVVPTRAGLQDTL 399 V++ L S + SGK ++ V T + + DTL Sbjct: 270 VIILLDSSGSMSGKEYQLAVATASAILDTL 299 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,614 Number of Sequences: 2352 Number of extensions: 8169 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -