BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30492 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 33 0.11 At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family pr... 29 1.9 At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 28 3.2 At4g28590.1 68417.m04089 expressed protein 27 5.7 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 5.7 At1g59077.1 68414.m06670 hypothetical protein 27 5.7 At1g58766.1 68414.m06659 hypothetical protein 27 5.7 At5g63450.1 68418.m07965 cytochrome P450, putative 27 7.5 At5g45460.1 68418.m05585 expressed protein 27 7.5 At2g04620.1 68415.m00470 cation efflux family protein potential ... 27 7.5 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 27 7.5 At1g20410.1 68414.m02545 expressed protein 27 7.5 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 7.5 At5g47690.1 68418.m05887 expressed protein 27 9.9 At5g07400.1 68418.m00847 forkhead-associated domain-containing p... 27 9.9 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 27 9.9 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 33.1 bits (72), Expect = 0.11 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = +3 Query: 3 DAPXMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKS 182 D + P+ +I+ + V +L S +P D+L++ L D DSA +K E K Sbjct: 155 DLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKMG 214 Query: 183 EVITNV 200 + N+ Sbjct: 215 SIAPNL 220 >At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family protein similar to CHY1 [gi:8572760]; contains Pfam profile PF00388 enoyl-CoA hydratase/isomerase family protein Length = 387 Score = 29.1 bits (62), Expect = 1.9 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 4/116 (3%) Frame = +3 Query: 180 SEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRL---IFAENAIKLMYK 350 +E IT V+ L R++ ++ Q +G K + DC EFRL I + MY Sbjct: 263 NEWITPVIKGLKRSSPTG-LKIVLQSIREGRKQTLSDCLKKEFRLTLNILRKTISPDMY- 320 Query: 351 RDGL-ALTLSNDVQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERN 515 +G+ ALT+ D PA D D +K L+E++ + +I TE N Sbjct: 321 -EGIRALTIDKD-NSPKWNPATLDEVDDEKINSVFK---LFEDDDIELQIPETEEN 371 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 28.3 bits (60), Expect = 3.2 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 8/70 (11%) Frame = -2 Query: 455 LPADSRACLVLAVAVGRSAIVA--------LNIIAQRQSETVALVHKLNRVFGEDKSELN 300 LP D +CL +A++ G A+ LN + Q +S+ A+ N +SE + Sbjct: 488 LPDDFLSCLGVALSPGNLAVALVRNFNVELLNPMYQARSQKAAVEFLWNGAQQSGESEDS 547 Query: 299 WETITDDVLG 270 ET+T+ +LG Sbjct: 548 TETVTEAILG 557 >At4g28590.1 68417.m04089 expressed protein Length = 331 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 344 HKLNRVFGEDKSELNWETITDD 279 H + V G+D SE++WE DD Sbjct: 180 HPIKNVVGDDGSEIDWEGEIDD 201 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 93 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 200 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 93 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 200 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 93 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 200 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At5g63450.1 68418.m07965 cytochrome P450, putative Length = 510 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 420 GKDKTSPRVSWKLIALWENNKVYFKILNTERN 515 G+D TS ++W L +N+ V KIL+ RN Sbjct: 306 GRDTTSAAMTWLFWLLSQNDDVETKILDELRN 337 >At5g45460.1 68418.m05585 expressed protein Length = 703 Score = 27.1 bits (57), Expect = 7.5 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 4/83 (4%) Frame = +3 Query: 60 YAADSDVPNDILEEQLYNSVVVADYDSAV----EKSKHLYEEKKSEVITNVVNKLIRNNK 227 +A ++P D E+L V DYD ++ ++ Y+E K E I ++ + N Sbjct: 611 WALRDNLPEDAEREKLVRYVTKVDYDQSLLMWHIATEFCYQEHKKETIPEGYDEQCKQNH 670 Query: 228 MNCMEYAYQLWLQGSKDIVRDCF 296 + + + L Q VR C+ Sbjct: 671 LRLHDVSPDLATQSD---VRGCW 690 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -2 Query: 110 VKLLLQNVVRDVGICSIQRCH 48 +K ++N+++ G+CSIQR H Sbjct: 727 LKEAMRNILKTKGVCSIQRLH 747 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 271 PRTSSVIVSQLSSDLSSPKTRLSLCTSATVS 363 PR + S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At1g20410.1 68414.m02545 expressed protein Length = 504 Score = 27.1 bits (57), Expect = 7.5 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 4/96 (4%) Frame = +3 Query: 27 IVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVN 206 I I+CL + L SDV ++++ +S VA V++ +H ++ EV +V + Sbjct: 97 ICIVCLGI--LQFVFSDVKKELVKSDS-SSDYVARITDLVKQDRHEFDSFGLEV--SVPS 151 Query: 207 KLIRNNKMNCM----EYAYQLWLQGSKDIVRDCFPV 302 ++ N + +Y+ ++WLQ K V+D V Sbjct: 152 TIMENERALLSYLKGKYSTEVWLQRDKISVKDALKV 187 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.1 bits (57), Expect = 7.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +1 Query: 46 SWHLCMLQIPTSLTTFWRSSFTIASSLPITTV 141 +W + +L +P ++ FW + +ASS + + Sbjct: 1086 TWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = +3 Query: 87 DILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIR 218 D+LE++ Y V+ + + +YE ++SEV+ + +K+++ Sbjct: 734 DMLEDKRYQPAVLQCLGCIAQIAMPVYETRESEVVEFIRSKILK 777 >At5g07400.1 68418.m00847 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1084 Score = 26.6 bits (56), Expect = 9.9 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = -2 Query: 410 GRSAIVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETITDDVLGALEPKLIGVLHAV 231 GR A + +++ + T + + RVF ++E+N V G PK +GV+ V Sbjct: 167 GRDASI-VSVSSGHSRGTFSSGKRSKRVFAPMENEIN-----SPVSGFYPPKAVGVVERV 220 Query: 230 HLVVSY 213 + +VSY Sbjct: 221 NSLVSY 226 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +3 Query: 33 ILCLFVASLYAA-DSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVN 206 +LC+ +++ DS + + + + +V DYD+ V+ S + E+ S ++TN V+ Sbjct: 405 LLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQDSLMLTNGVD 463 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,270,504 Number of Sequences: 28952 Number of extensions: 165498 Number of successful extensions: 714 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -