BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30491 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47500.1 68415.m05929 kinesin motor protein-related 48 5e-06 At5g27000.1 68418.m03221 kinesin motor protein-related non-conse... 47 7e-06 At5g41310.1 68418.m05020 kinesin motor protein-related 44 5e-05 At1g63640.2 68414.m07198 kinesin motor protein-related C-termina... 43 1e-04 At1g63640.1 68414.m07197 kinesin motor protein-related C-termina... 43 1e-04 At3g10310.1 68416.m01237 kinesin motor protein-related similar t... 43 1e-04 At1g09170.1 68414.m01024 kinesin motor protein-related similar t... 40 0.001 At3g44730.1 68416.m04814 kinesin motor protein-related similar t... 36 0.021 At5g35700.1 68418.m04269 fimbrin-like protein, putative similar ... 35 0.037 At5g48460.1 68418.m05992 fimbrin-like protein, putative strong s... 34 0.049 At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical t... 34 0.065 At5g55400.1 68418.m06902 fimbrin-like protein, putative similar ... 33 0.086 At2g04750.1 68415.m00485 fimbrin-like protein, putative similar ... 33 0.15 At5g62240.1 68418.m07815 expressed protein various predicted pro... 31 0.35 At5g25475.2 68418.m03031 expressed protein 31 0.46 At5g25475.1 68418.m03030 expressed protein 31 0.46 At3g59100.1 68416.m06589 glycosyl transferase family 48 protein ... 31 0.46 At3g11170.1 68416.m01355 omega-3 fatty acid desaturase, chloropl... 30 1.1 At5g25470.2 68418.m03029 expressed protein 29 1.4 At5g25470.1 68418.m03028 expressed protein 29 1.4 At2g25730.1 68415.m03084 expressed protein 29 1.9 At3g07070.1 68416.m00840 protein kinase family protein contains ... 29 2.5 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 29 2.5 At2g31010.1 68415.m03781 protein kinase family protein contains ... 29 2.5 At2g45600.1 68415.m05670 expressed protein low similarity to PrM... 28 3.2 At2g17010.1 68415.m01961 mechanosensitive ion channel domain-con... 28 4.3 At5g51420.1 68418.m06375 long-chain-alcohol O-fatty-acyltransfer... 27 7.5 At3g48710.1 68416.m05319 expressed protein putative protein - Ar... 27 7.5 At3g04450.1 68416.m00472 myb family transcription factor contain... 27 7.5 At1g72300.1 68414.m08358 leucine-rich repeat transmembrane prote... 27 9.9 At1g51150.1 68414.m05750 DegP protease family contains similarit... 27 9.9 >At2g47500.1 68415.m05929 kinesin motor protein-related Length = 974 Score = 47.6 bits (108), Expect = 5e-06 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 12/101 (11%) Frame = +2 Query: 101 DVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN------------FQLME 244 D+ EP G LR G+ILCK+ NK+ PG+V K+ E + FQ E Sbjct: 65 DLPAEPTEEGLRLG-LRSGIILCKVLNKVQPGAVSKVVESPCDAILVADGAPLSAFQYFE 123 Query: 245 NIQRFQAAIKKYGVPEEEIFQTADPFERRNIPQVTLCLYAL 367 N++ F AI++ G P F+ +D + N +V C+ A+ Sbjct: 124 NVRNFLVAIQEMGFP---TFEASDLEQGGNASRVVNCVLAI 161 >At5g27000.1 68418.m03221 kinesin motor protein-related non-consensus AT donor splice site at exon 12; non-consensus AC acceptor splice site at exon 13 Length = 987 Score = 47.2 bits (107), Expect = 7e-06 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 17/113 (15%) Frame = +2 Query: 80 EVLTWISDVLG----EPLPNGAYEDV----LRDGVILCKLANKLAPGSVKKIQERGTN-- 229 E W+ D++G + P E+ LR G++LC + NK+ PGSV K+ E + Sbjct: 49 EAAGWLRDMIGVSNGKDFPGEPSEEEFRLGLRSGIVLCNVLNKVNPGSVSKVVEAPDDVA 108 Query: 230 -------FQLMENIQRFQAAIKKYGVPEEEIFQTADPFERRNIPQVTLCLYAL 367 FQ ENI+ F AI++ G+P F+ +D + ++ C+ AL Sbjct: 109 DGAALSAFQYFENIRNFLVAIEEMGLPS---FEASDMEKGGKSIRIVNCILAL 158 >At5g41310.1 68418.m05020 kinesin motor protein-related Length = 961 Score = 44.4 bits (100), Expect = 5e-05 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 6/85 (7%) Frame = +2 Query: 62 NKDQEQEVLTWISDVLGE-PLPNGAYEDVLR----DGVILCKLANKLAPGSVKKIQERGT 226 NK Q ++ W+++ L LP A E+ LR DG +LC L N+L+PGS++ G Sbjct: 39 NKQGHQSLVEWLNETLPYLNLPWEASEEELRACLVDGTVLCNLLNQLSPGSMR----MGG 94 Query: 227 NFQL-MENIQRFQAAIKKYGVPEEE 298 +F+ NI+RF AA+ + +P E Sbjct: 95 SFEPGCVNIERFLAAMDEMTLPRFE 119 >At1g63640.2 68414.m07198 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1065 Score = 43.2 bits (97), Expect = 1e-04 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +2 Query: 62 NKDQEQEVLTWISDVLGE-PLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGT 226 +K Q ++ W+++ L LP A ED LRDG +LC L N+L+PGS++ G Sbjct: 38 SKKGHQSLVEWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSMR----MGG 93 Query: 227 NFQ-LMENIQRFQAAIKKYGVPEEEI 301 +F+ I+RF A+ + +P E+ Sbjct: 94 SFEPASVKIERFLTAMDEMALPRFEV 119 >At1g63640.1 68414.m07197 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1064 Score = 43.2 bits (97), Expect = 1e-04 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +2 Query: 62 NKDQEQEVLTWISDVLGE-PLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGT 226 +K Q ++ W+++ L LP A ED LRDG +LC L N+L+PGS++ G Sbjct: 38 SKKGHQSLVEWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSMR----MGG 93 Query: 227 NFQ-LMENIQRFQAAIKKYGVPEEEI 301 +F+ I+RF A+ + +P E+ Sbjct: 94 SFEPASVKIERFLTAMDEMALPRFEV 119 >At3g10310.1 68416.m01237 kinesin motor protein-related similar to carboxy-terminal kinesin 2 GB:P79955 [Xenopus laevis] Length = 897 Score = 42.7 bits (96), Expect = 1e-04 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 16/112 (14%) Frame = +2 Query: 80 EVLTWISDVLGE-PLPNGAYE----DVLRDGVILCKLANKLAPGSVKKIQERGT------ 226 + + W+ V+G+ +PN E LR+G+ILC NK+ PG+V K+ E + Sbjct: 24 QAVQWLKSVVGQLGIPNQPSEKEFISCLRNGMILCNAINKIHPGAVSKVVENYSYLNGEY 83 Query: 227 ----NFQLMENIQRFQAAIKKYGVPEEEIFQ-TADPFERRNIPQVTLCLYAL 367 +Q EN++ F A++ +P E D E ++ +V C+ L Sbjct: 84 QLPPAYQYFENVRNFLVALETLRLPGFEASDLEKDNLESGSVTKVVDCILGL 135 >At1g09170.1 68414.m01024 kinesin motor protein-related similar to GB:AAB61066 Length = 1010 Score = 39.5 bits (88), Expect = 0.001 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 20/94 (21%) Frame = +2 Query: 80 EVLTWISDVLG----EPLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGTN-- 229 E W+ + LG LP E+ LR G++LC + N++ PG+V K+ E + Sbjct: 59 EAARWVRNTLGVVGGRDLPADPSEEDFRIALRSGILLCNVLNRVKPGAVPKVVEAPNDPL 118 Query: 230 ----------FQLMENIQRFQAAIKKYGVPEEEI 301 FQ EN++ F +++ G+P E+ Sbjct: 119 VNQDGAALSAFQYFENLRNFLVFVEEMGIPTFEV 152 >At3g44730.1 68416.m04814 kinesin motor protein-related similar to 4 other kinesin-like proteins of A. thaliana: F02P16.12 (PID:g2191180), katA (D11371), katB (D21137), and katC (D21138); contains non-consensus AT-AC splice sites at intron 10 Length = 1087 Score = 35.5 bits (78), Expect = 0.021 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +2 Query: 113 EPLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQE 217 E LP ED LR+G+ILC + NK+ PGSV K+ E Sbjct: 7 ETLPEKPSEDEFSLALRNGLILCNVLNKVNPGSVLKVVE 45 >At5g35700.1 68418.m04269 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893, fimbrin [Schizosaccharomyces pombe] GI:3057144; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 687 Score = 34.7 bits (76), Expect = 0.037 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +2 Query: 113 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN 229 +P N A+ D+++DGV+LCKL N PG+ I ER N Sbjct: 149 DPATN-AFFDLVKDGVLLCKLINVAVPGT---IDERAIN 183 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +2 Query: 92 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 202 WI+ + N +ED LR+G +L ++ +K++PGSV Sbjct: 401 WINSLGTATYVNNVFED-LRNGWVLLEVLDKVSPGSV 436 >At5g48460.1 68418.m05992 fimbrin-like protein, putative strong similarity to fimbrin-like protein AtFim2 [Arabidopsis thaliana] GI:2737926; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 654 Score = 34.3 bits (75), Expect = 0.049 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +2 Query: 116 PLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 247 P N +E V +DGV+LCKL N PG+ I ER N + M N Sbjct: 152 PSSNDLFE-VAKDGVLLCKLINVAVPGT---IDERAINTKSMLN 191 Score = 31.9 bits (69), Expect = 0.26 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +2 Query: 71 QEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 202 +E+ WI+ G N +ED LRDG IL + +K++PG V Sbjct: 396 EEKAFRFWINSFDGSVYINNVFED-LRDGWILLQTLDKVSPGIV 438 >At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893 Length = 687 Score = 33.9 bits (74), Expect = 0.065 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 113 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 247 +P N YE +++DGV+LCKL N PG+ I ER N + + N Sbjct: 150 DPHSNQLYE-LVKDGVLLCKLINVAVPGT---IDERAINTKRVLN 190 >At5g55400.1 68418.m06902 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 714 Score = 33.5 bits (73), Expect = 0.086 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 113 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 247 +P N YE +++DGV+LCKL N PG+ I ER N + + N Sbjct: 151 DPDSNDLYE-LVKDGVLLCKLINIAVPGT---IDERAINTKRVLN 191 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +2 Query: 92 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 202 WI+ + E N +EDV R+G IL ++ +K+ PGSV Sbjct: 402 WINSLGIESYVNNVFEDV-RNGWILLEVVDKVYPGSV 437 >At2g04750.1 68415.m00485 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 652 Score = 32.7 bits (71), Expect = 0.15 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +2 Query: 116 PLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN 229 P N + D+++DGV+LCKL N PG+ I ER N Sbjct: 144 PTTNALF-DLVKDGVLLCKLINIAVPGT---IDERAIN 177 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 92 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 202 W++ + + +EDV R+G +L ++ +K++PGSV Sbjct: 397 WMNSLGAVTYVDNVFEDV-RNGWVLLEVLDKVSPGSV 432 >At5g62240.1 68418.m07815 expressed protein various predicted proteins, Arabidopsis thaliana; expression supported by MPSS Length = 366 Score = 31.5 bits (68), Expect = 0.35 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +2 Query: 164 LCKLANKLAPGSVKKIQERGTNFQLMENIQRFQAAIKKYGVPEEEIFQTADPFER 328 L K +AP V K+Q + TN Q E ++ K VP+E +TA+ ER Sbjct: 161 LAKFGENVAPVLVSKLQNQDTNRQKQEAKVAHVSSRAKLTVPKEPNLRTAERSER 215 >At5g25475.2 68418.m03031 expressed protein Length = 282 Score = 31.1 bits (67), Expect = 0.46 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 113 LPKHQRSK*EPLVLGPCFWQALCAGEIW 30 LPK+ K + V PCFW++L G+ W Sbjct: 2 LPKNAIEKIQANVSKPCFWKSLSPGQTW 29 >At5g25475.1 68418.m03030 expressed protein Length = 282 Score = 31.1 bits (67), Expect = 0.46 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 113 LPKHQRSK*EPLVLGPCFWQALCAGEIW 30 LPK+ K + V PCFW++L G+ W Sbjct: 2 LPKNAIEKIQANVSKPCFWKSLSPGQTW 29 >At3g59100.1 68416.m06589 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1934 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -1 Query: 198 DPGANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRTSCSWSLF 61 D A+ N ITP + +G PKT+ ++VRT W+LF Sbjct: 444 DLKADFFLNSDEITPQDERLNQVTYGKSKPKTNFVEVRT--FWNLF 487 >At3g11170.1 68416.m01355 omega-3 fatty acid desaturase, chloroplast (FAD7) (FADD) identical to omega-3 fatty acid desaturase, chloroplast precursor SP:P46310 [Arabidopsis thaliana (Mouse-ear cress)]; identical to Pfam profile PF00487: Fatty acid desaturase; identical to cDNA plastid fatty acid desaturase GI:809491 Length = 446 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -1 Query: 204 FTDPGANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRT--SCSWSL 64 +T P +N L+N + PSLS+SSY S SP + + R + +W+L Sbjct: 18 YTTPRSNFLSNNNKFRPSLSSSSYKT--SSSPLSFGLNSRDGFTRNWAL 64 >At5g25470.2 68418.m03029 expressed protein Length = 280 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 113 LPKHQRSK*EPLVLGPCFWQALCAGEIW 30 LP++ K + V PCFW++L G+ W Sbjct: 2 LPRNATDKIQGNVSKPCFWKSLSPGQNW 29 >At5g25470.1 68418.m03028 expressed protein Length = 280 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 113 LPKHQRSK*EPLVLGPCFWQALCAGEIW 30 LP++ K + V PCFW++L G+ W Sbjct: 2 LPRNATDKIQGNVSKPCFWKSLSPGQNW 29 >At2g25730.1 68415.m03084 expressed protein Length = 2464 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 489 RLSSALWARSCSSVKVRSFLSAI 421 R + LW+RSC S + SFLS I Sbjct: 52 RFDNVLWSRSCPSPSLLSFLSTI 74 >At3g07070.1 68416.m00840 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 414 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +2 Query: 59 RNKDQEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQL 238 R KD EQ ++TW V EP D +GV K N+ + +QE T L Sbjct: 287 RPKD-EQNLVTWAQPVFKEPSRFPELADPSLEGVFPEKALNQAVAVAAMCLQEEATVRPL 345 Query: 239 MENI 250 M ++ Sbjct: 346 MSDV 349 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 142 CAKGRCDPLQIGQQISSWISEKNPRERNQLPAHG 243 C + R L G I S + EK PR+R + PA+G Sbjct: 356 CTEKRPVSLLAGAGIVSVVDEKRPRKRGRKPANG 389 >At2g31010.1 68415.m03781 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 775 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 92 WISDVLGEPLPNGAYEDVLRDGVILCKLANKL-APGSVKKIQERGTNFQLM 241 W + +L EP+PNG Y V+ D + +L N+L P + + E G +++ Sbjct: 57 WDTGILSEPIPNGFY-SVVPDKRVK-ELYNRLPTPSELHALGEEGVRIEVI 105 >At2g45600.1 68415.m05670 expressed protein low similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +2 Query: 23 LETRFRL---HTMPARNKDQEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCK 172 L +RL H +PA +D + +L W+ D P+ G + L+DGV K Sbjct: 103 LSVEYRLAPEHRLPAAYEDAVEAIL-WLRDQARGPINGGDCDTWLKDGVDFSK 154 >At2g17010.1 68415.m01961 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 779 Score = 27.9 bits (59), Expect = 4.3 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%) Frame = +2 Query: 26 ETRFRLH--TMPARNKDQEQEVLTWIS-DVLGEPLPNGAYEDVLRDGVILCKLANKLAPG 196 ETR R++ + A N + +++ +S L E + YED + K A A Sbjct: 406 ETRSRMNHKNISAWNMKRLMKIVRNVSLTTLDEQMLESTYEDESTRQIRSEKEAKAAARK 465 Query: 197 SVKKIQERGTNFQLMENIQRF 259 K +++RG + +E++ RF Sbjct: 466 IFKNVEQRGAKYIYLEDLMRF 486 >At5g51420.1 68418.m06375 long-chain-alcohol O-fatty-acyltransferase family protein / wax synthase family protein contains similarity to wax synthase wax synthase - Simmondsia chinensis, PID:g5020219 similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 435 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 307 LEYFFFWYSVFLDCRLEPLNVLHELEVGSSLLDFF 203 L+ F ++S+ LDC LEP L+E + SL DF+ Sbjct: 170 LKLFNAFFSIALDCELEP--QLNEPYLAYSLRDFW 202 >At3g48710.1 68416.m05319 expressed protein putative protein - Arabidopsis thaliana, EMBL:AL078465.1 Length = 462 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 204 KKSKREEPTSSSWRTFKGSKRQSRNTEYQKKK 299 K++K+E+P + ++ KGS + SR + Q K Sbjct: 307 KRTKKEKPAAEEEKSIKGSAKSSRKSFRQVDK 338 >At3g04450.1 68416.m00472 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 438 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 44 HTMPARNKDQEQEVLTWISD 103 H++ N+ QEQ+++TW SD Sbjct: 113 HSLQLINQPQEQKIMTWSSD 132 >At1g72300.1 68414.m08358 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3641252 from [Malus x domestica] (Plant Mol. Biol. 40 (6), 945-957 (1999)) Length = 1095 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = +2 Query: 332 NIPQVTLCLYALGRITQKHPEFTGPQLGPKMADKNERTFTEEQLRAHNAELNLQMGFNKG 511 N+P L L L R+ H +GP ++ ++ + + EL LQ F G Sbjct: 107 NLPSSVLDLQRLSRLDLSHNRLSGPLPPGFLSALDQLLVLDLSYNSFKGELPLQQSFGNG 166 Query: 512 A 514 + Sbjct: 167 S 167 >At1g51150.1 68414.m05750 DegP protease family contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 219 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 254 RFQAAIKKYGVPEEEIFQTADPFERRNIPQVTLCLYALG 370 R+ + G+ EE ++ +P E IP + +YALG Sbjct: 126 RYGCDLAILGIDSEEFWEDINPLELGGIPFIGETVYALG 164 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,692,374 Number of Sequences: 28952 Number of extensions: 281772 Number of successful extensions: 894 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -