SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30490
         (516 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   2.1  
AF264720-1|AAF75272.1|  126|Tribolium castaneum putative cytochr...    22   3.7  
X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Triboliu...    21   8.6  
U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II p...    21   8.6  
U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I pr...    21   8.6  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.6 bits (46), Expect = 2.1
 Identities = 9/40 (22%), Positives = 16/40 (40%)
 Frame = +1

Query: 355  CAWPRGKVLGGSSSINLMFYVRGNKADYDEWAADGNEGWS 474
            C WP      G+S++N++  V   K      +      W+
Sbjct: 1320 CDWPEKATCDGTSNVNVVDIVTTAKPAQSTTSVSTTTSWN 1359


>AF264720-1|AAF75272.1|  126|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q1 protein.
          Length = 126

 Score = 21.8 bits (44), Expect = 3.7
 Identities = 8/23 (34%), Positives = 12/23 (52%)
 Frame = -3

Query: 484 LPRNSSLRFHRQPIRRNRPCYPE 416
           LP+ S+   H   + RN   YP+
Sbjct: 81  LPKESNAIIHIYDVHRNADIYPD 103


>X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Tribolium
           castaneum mRNAfor alhpa amylase 3'region. ).
          Length = 489

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 76  AGDHLWPAD 102
           A  H+WPAD
Sbjct: 204 AAKHMWPAD 212


>U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II
           protein.
          Length = 490

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 76  AGDHLWPAD 102
           A  H+WPAD
Sbjct: 205 AAKHMWPAD 213


>U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I
           protein.
          Length = 490

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 76  AGDHLWPAD 102
           A  H+WPAD
Sbjct: 205 AAKHMWPAD 213


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.315    0.133    0.426 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,869
Number of Sequences: 336
Number of extensions: 2577
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12363686
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)

- SilkBase 1999-2023 -