BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30490 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66494-4|CAA91263.1| 599|Caenorhabditis elegans Hypothetical pr... 89 2e-18 AF100656-10|AAF99967.1| 301|Caenorhabditis elegans Hypothetical... 28 3.4 AF039047-5|AAY86265.1| 188|Caenorhabditis elegans Hypothetical ... 27 6.0 >Z66494-4|CAA91263.1| 599|Caenorhabditis elegans Hypothetical protein C34C6.4 protein. Length = 599 Score = 88.6 bits (210), Expect = 2e-18 Identities = 47/116 (40%), Positives = 67/116 (57%), Gaps = 4/116 (3%) Frame = +1 Query: 181 NRLSEISDWKVLLVEAGG-NPTLATEIPQP---YYSNMGTSEDWAYHTEPQEGACRAYKN 348 NRL+E +VLL+EAG + I P Y+ + +W YHT Q+ N Sbjct: 54 NRLTEDPSNRVLLIEAGPVDHKWDWRIHMPAALMYNLCSDTYNWHYHTTAQKNL----GN 109 Query: 349 KGCAWPRGKVLGGSSSINLMFYVRGNKADYDEWAADGNEGWSFEEVLPYFKKSESF 516 + WPRG+V GGSS++N M YVRG+ DY+ W +G GW++ LPYFKK+E++ Sbjct: 110 RVFYWPRGRVWGGSSTLNAMCYVRGHAYDYNRWEKEGASGWNYANCLPYFKKAETY 165 >AF100656-10|AAF99967.1| 301|Caenorhabditis elegans Hypothetical protein F49F1.11 protein. Length = 301 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 277 NMGTSEDWAYH--TEPQEGACRAYKNKGCAWPRGKVLGGS 390 N+ S+ W +H +EP +G ++ AW G+ GG+ Sbjct: 129 NLAKSKVWVFHFASEPTKGLVARTRHTNGAWEVGETYGGN 168 >AF039047-5|AAY86265.1| 188|Caenorhabditis elegans Hypothetical protein K11D12.13 protein. Length = 188 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 274 SNMGTSEDWAYHTEPQEGACRAYKNKGC 357 SN YH +P+ C A+K +GC Sbjct: 32 SNCSYEASIRYHFDPKTNICHAFKYEGC 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.315 0.133 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,645,262 Number of Sequences: 27780 Number of extensions: 240932 Number of successful extensions: 697 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -