BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30488 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po... 30 0.24 SPBC4F6.10 |vps901|vps9a|guanyl-nucleotide exchange factor Vps90... 28 0.72 SPAC1D4.07c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 6.7 SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pom... 25 6.7 SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Sch... 25 8.9 >SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces pombe|chr 3|||Manual Length = 401 Score = 29.9 bits (64), Expect = 0.24 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +2 Query: 350 LTNLMKKMLSYGQYNMDKYTYV 415 LTN +K+++SY +YNM + TY+ Sbjct: 193 LTNYLKEVISYRKYNMMEETYI 214 >SPBC4F6.10 |vps901|vps9a|guanyl-nucleotide exchange factor Vps901 |Schizosaccharomyces pombe|chr 2|||Manual Length = 537 Score = 28.3 bits (60), Expect = 0.72 Identities = 25/73 (34%), Positives = 33/73 (45%) Frame = -3 Query: 412 VGVLVHVVLAIAQHFLHQVGQVDNFSIVANNF*ATEDQTGEVFNVLRLLQAYNSAVTTLD 233 V +L+ VVL L V N + F + E TGEV L L S + TLD Sbjct: 299 VPILIFVVLQARPAHL-----VSNIQYI-QRFRSPEKLTGEVMYYLSTLMGAMSFIETLD 352 Query: 232 LSSKDTLSDHHFN 194 SS T+++ FN Sbjct: 353 CSSL-TITEEEFN 364 >SPAC1D4.07c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 25.0 bits (52), Expect = 6.7 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +2 Query: 365 KKMLSYGQYNMDKYTYVPTSLDMYTTCLRDPVFWMIMKRVCNIF 496 K++LS Y + Y+ + L MY +R ++ +K + NIF Sbjct: 30 KRILSILPYYKNSYSDFISVLQMYKVHIRMVSIYIFLKALSNIF 73 >SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 566 Score = 25.0 bits (52), Expect = 6.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 448 PRSCLLDDHETSLQHLHRFQEHA 516 P+ +L HE S++HL R E A Sbjct: 133 PKEKILTAHEASVRHLRRLTESA 155 >SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 3|||Manual Length = 791 Score = 24.6 bits (51), Expect = 8.9 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -3 Query: 514 HVLENGEDVANSFHDHPEDR 455 H++EN +A+ FH+ E + Sbjct: 28 HIVENSSPIASKFHEFDEQK 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,992,412 Number of Sequences: 5004 Number of extensions: 37118 Number of successful extensions: 115 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -