BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30485 (342 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1048 + 10770461-10770612,10770721-10770730,10771457-107716... 27 2.9 03_05_0845 - 28155065-28155374,28156201-28156342,28156375-281565... 26 8.9 >12_01_1048 + 10770461-10770612,10770721-10770730,10771457-10771624, 10771668-10772017,10772107-10772508,10772940-10773318, 10773801-10774046 Length = 568 Score = 27.5 bits (58), Expect = 2.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 150 GNVRCRRLESTLVSDVGHSVSNTVRADVRKFSAN 49 G CRR +S ++ GHS++ T V F +N Sbjct: 174 GEACCRREKSQAIAGPGHSIAVTTSGAVYTFGSN 207 >03_05_0845 - 28155065-28155374,28156201-28156342,28156375-28156505, 28156591-28156784,28156859-28156969,28157234-28157399, 28157501-28157668,28157766-28158787 Length = 747 Score = 25.8 bits (54), Expect = 8.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 49 VRGEFAYIGPDGVTYAVTYVAN 114 + G+ ++GPDG TY + A+ Sbjct: 96 IEGQGVFVGPDGATYRGAWAAD 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,349,075 Number of Sequences: 37544 Number of extensions: 140077 Number of successful extensions: 284 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 482105440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -