Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30478
         (500 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q3E9W3 Cluster: Uncharacterized protein At4g26370.2; n=...    33   2.7  

>UniRef50_Q3E9W3 Cluster: Uncharacterized protein At4g26370.2; n=4;
           core eudicotyledons|Rep: Uncharacterized protein
           At4g26370.2 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 248

 Score = 33.5 bits (73), Expect = 2.7
 Identities = 20/63 (31%), Positives = 30/63 (47%)
 Frame = +1

Query: 193 IKMTSGLCYFTEFKIDNSHAHCDLSYNIHTRATVYVSGRMGCAREASSGHECYLNPSLCP 372
           ++ +S LCYF+     +SH     +     R T  VS R G  R +SS    +L+P+   
Sbjct: 10  LRSSSNLCYFSSNVSPDSHRSIGFTLVDSLRPTNLVSLRTGNKRSSSSSLRLFLSPTRSA 69

Query: 373 LST 381
           L T
Sbjct: 70  LRT 72


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 464,897,042
Number of Sequences: 1657284
Number of extensions: 8228913
Number of successful extensions: 18118
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17561
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18110
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 29691847201
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)