BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30475 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023171-1|AAY55587.1| 320|Drosophila melanogaster IP10807p pro... 29 2.8 AE014134-615|AAF51099.1| 320|Drosophila melanogaster CG15414-PA... 29 2.8 >BT023171-1|AAY55587.1| 320|Drosophila melanogaster IP10807p protein. Length = 320 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 362 LPSHRPPPEQSSSTLPGATEVIHNAFPEVFFATYHPAME*APLHGVS 502 LP+ R P +S + P A+ V H P+ +TY P AP+ +S Sbjct: 69 LPTARVPIPRSRPSAPAASIVSHYLPPKPVVSTYIPPPAAAPISSIS 115 >AE014134-615|AAF51099.1| 320|Drosophila melanogaster CG15414-PA protein. Length = 320 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 362 LPSHRPPPEQSSSTLPGATEVIHNAFPEVFFATYHPAME*APLHGVS 502 LP+ R P +S + P A+ V H P+ +TY P AP+ +S Sbjct: 69 LPTARVPIPRSRPSAPAASIVSHYLPPKPVVSTYIPPPAAAPISSIS 115 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,883,947 Number of Sequences: 53049 Number of extensions: 401686 Number of successful extensions: 1149 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1149 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -