BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30465 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 4.6 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 8.1 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 379 LTYLCILKKVIKYDIYEVLLTVC 311 +T LC + KV + IY+ LL C Sbjct: 620 ITSLCAIAKVFELVIYKNLLHAC 642 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 22.6 bits (46), Expect = 8.1 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 229 DFILFF*TLVAKCRYRNVKSQXXQY*PATSGPVRVTMFNRAMDI 98 D I F LVA+ R RNV+ P + R TM R + + Sbjct: 288 DLIHDFNQLVARFRERNVEPIMTTLTPIANSGGRTTMAERLLKL 331 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 425,689 Number of Sequences: 2352 Number of extensions: 7130 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -