BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30463 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 22 2.8 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 4.9 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 6.5 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 6.5 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 8.6 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 22.2 bits (45), Expect = 2.8 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +1 Query: 91 LQRDDAAALRGGGPRPDRATSCRGAVLVLVLEHEPALGGQ 210 L RD L GG PD + +++ H P + GQ Sbjct: 124 LVRDGKPCLSGGPKHPDPGSLQVPGAPMMMSSHGPLMYGQ 163 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 4.9 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = -2 Query: 374 KWCRRAGGRCW 342 +WC + G CW Sbjct: 583 RWCYQNEGECW 593 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 131 GPPPRSAAASSRCRWTCRADASC 63 G PP+ + S+ R+T RA C Sbjct: 271 GLPPQVPSPRSQRRYTGRATCDC 293 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -2 Query: 158 RHDVARSGRGPPPRSAAASSRC 93 RH PR+ ASSRC Sbjct: 281 RHTTTSHNTRGTPRTTPASSRC 302 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 86 TCRADASCRSHSRIP 42 +C AD SC S + P Sbjct: 115 SCHADKSCASDDKSP 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,566 Number of Sequences: 336 Number of extensions: 1214 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -