BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30460 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005233-1|AAH05233.1| 186|Homo sapiens PNLIPRP1 protein protein. 29 7.3 BC105005-1|AAI05006.1| 773|Homo sapiens diacylglycerol kinase, ... 29 9.7 >BC005233-1|AAH05233.1| 186|Homo sapiens PNLIPRP1 protein protein. Length = 186 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 302 SFHHFIDLKTYTRIRIAMFISIFAPIKIKCLSMFFFY 412 S HHF+ + + M + F+ K+KCLSMF Y Sbjct: 129 SLHHFMHSRNLYILGNFMQLKCFSSQKLKCLSMFPHY 165 >BC105005-1|AAI05006.1| 773|Homo sapiens diacylglycerol kinase, beta 90kDa protein. Length = 773 Score = 29.1 bits (62), Expect = 9.7 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = -3 Query: 334 VSFQVYKM-METFLLPL*VDEHTAHLMVS-GNRRPWTSAMPGAEPS 203 + F+ +K+ M+TFL D+ TAHL +S N+ P +S M ++P+ Sbjct: 58 IDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPA 103 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,317,311 Number of Sequences: 237096 Number of extensions: 1187222 Number of successful extensions: 1731 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1731 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -