BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30457 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.5 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 5.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 5.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 7.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 10.0 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 10.0 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.5 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +2 Query: 182 ELEKLISTAPETRRPQLEKEFKGFKTLFSRFLAEQGP---SVTWEKIEKLPEGAVIDYNS 352 E+EKL S ++R P T + L+++GP + +++K+ D Sbjct: 71 EIEKLGSERSKSRSPDSRDRSNASNTSKTVILSDKGPEGIQINATELQKIKLEIHRDLPG 130 Query: 353 LSTPTTDNV 379 ST TT V Sbjct: 131 KSTTTTVEV 139 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 2.5 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +2 Query: 182 ELEKLISTAPETRRPQLEKEFKGFKTLFSRFLAEQGP---SVTWEKIEKLPEGAVIDYNS 352 E+EKL S ++R P T + L+++GP + +++K+ D Sbjct: 71 EIEKLGSERSKSRSPDSRDRSNASNTSKTVILSDKGPEGIQINATELQKIKLEIHRDLPG 130 Query: 353 LSTPTTDNV 379 ST TT V Sbjct: 131 KSTTTTVEV 139 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 379 HVVRRWRGQTVI 344 HVVR WRG + Sbjct: 1322 HVVRPWRGSATL 1333 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 169 STGGGAGEAHLHGP 210 S GG +AHL GP Sbjct: 17 SAGGHGFDAHLRGP 30 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 379 HVVRRWRGQTVI 344 HVVR WRG + Sbjct: 1318 HVVRPWRGSATL 1329 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 169 STGGGAGEAHLHGP 210 S GG +AHL GP Sbjct: 17 SAGGHGFDAHLRGP 30 Score = 20.6 bits (41), Expect = 10.0 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 36 LVISVIT*RNEARNQRLR*KDSQSPAXRRQGLVTSRRPPNVMP 164 LVI+ + + +A ++ Q + RR G V PP + P Sbjct: 573 LVITSVQKKGDAGVYTCSARNKQGHSARRSGDVAVIVPPKISP 615 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 7.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 182 ELEKLISTAPETRRPQLEKEFKGFKTLFSRFLAEQGP 292 E+EKL S ++R P + T + L+++GP Sbjct: 71 EIEKLGSERSKSRSPDSRDKSNTSNTSKTIILSDKGP 107 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.5 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +2 Query: 182 ELEKLISTAPETRRPQLEKEFKGFKTLFSRFLAEQGP---SVTWEKIEKLPEGAVIDYNS 352 E+EKL S ++R P T + L+++GP + +++K+ D Sbjct: 71 EIEKLGSERSKSRSPDSRDRSNTSNTSKTVILSDKGPEGIQINATELQKIKLEIHRDLPG 130 Query: 353 LSTPTTDNV 379 ST TT V Sbjct: 131 KSTITTVEV 139 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 485 SGHSELGSRIWGPY 444 S +++ SRIWG Y Sbjct: 627 SEYNQYNSRIWGGY 640 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 485 SGHSELGSRIWGPY 444 S +++ SRIWG Y Sbjct: 627 SEYNQYNSRIWGGY 640 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,570 Number of Sequences: 438 Number of extensions: 2910 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -