BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30455 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 2.1 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 8.6 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.6 bits (46), Expect = 2.1 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 142 DKVP*SWKQHCVPLETASRDWXDLNVLKTEIEEAKPK 252 D P W QH L T + D + TE+ + +PK Sbjct: 220 DTAPPQWYQHQPLLFTYTDDGKNQQRTGTELTKMRPK 256 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 101 SGCDLRNAPRTMLKTKF 151 SGC + N PR ++KF Sbjct: 19 SGCLITNCPRGGKRSKF 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,047 Number of Sequences: 336 Number of extensions: 1712 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -