Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30455
         (516 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT...    27   5.7  

>At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT3)
           identical to potassium channel [Arabidopsis thaliana]
           gi|1100898|gb|AAA97865; Note: also identical to AKT3
           [Arabidopsis thaliana] gi|1172218|gb|AAA96153, which is
           a truncated version of AKT2, PMID:10852932; member of
           the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+
           channel family, PMID:11500563; identical to cDNA
           inward-rectifying K+ channel (AKT3) GI:1172219
          Length = 802

 Score = 27.5 bits (58), Expect = 5.7
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -2

Query: 167 CFQLQGTLSSALFLVHCEGHNRCNLTKVISQHTGSENRYQDSLPH 33
           CF+L   LS  LFLVHC G   C+   +  ++      + D++P+
Sbjct: 216 CFRL---LSVTLFLVHCAG---CSYYLIADRYPHQGKTWTDAIPN 254


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,492,606
Number of Sequences: 28952
Number of extensions: 160286
Number of successful extensions: 330
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 329
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 330
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 937669760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)