BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30455 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT... 27 5.7 >At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT3) identical to potassium channel [Arabidopsis thaliana] gi|1100898|gb|AAA97865; Note: also identical to AKT3 [Arabidopsis thaliana] gi|1172218|gb|AAA96153, which is a truncated version of AKT2, PMID:10852932; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563; identical to cDNA inward-rectifying K+ channel (AKT3) GI:1172219 Length = 802 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 167 CFQLQGTLSSALFLVHCEGHNRCNLTKVISQHTGSENRYQDSLPH 33 CF+L LS LFLVHC G C+ + ++ + D++P+ Sbjct: 216 CFRL---LSVTLFLVHCAG---CSYYLIADRYPHQGKTWTDAIPN 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,492,606 Number of Sequences: 28952 Number of extensions: 160286 Number of successful extensions: 330 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 330 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -