BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30453 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 0.81 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 2.5 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 5.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 10.0 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 10.0 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 10.0 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 21 10.0 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.2 bits (50), Expect = 0.81 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 125 FVTSGVAISMAQFGLVFGITAILIPQLQSQKRVMLIDESTESWIAAI 265 F+ GV I + GL+ A Q++ QK++ L + + W AI Sbjct: 827 FIVVGVGI-IGGIGLIIIEVAYKKHQIRKQKKMELARHAADKWRGAI 872 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 317 KYGRKVANIISVLPVIVGWLL 379 +YGR V I+V + V WLL Sbjct: 132 RYGRWVTRRIAVAGIAVVWLL 152 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 74 KKQKTKENSNSAE*HREFELN 12 K+ KTK++ S H E E N Sbjct: 39 KRPKTKKSQGSRTTHNELEKN 59 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 430 LKKSCSQDEVC 398 LKK C Q+E C Sbjct: 262 LKKLCPQEEAC 272 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 430 LKKSCSQDEVC 398 LKK C Q+E C Sbjct: 177 LKKLCPQEEAC 187 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 430 LKKSCSQDEVC 398 LKK C Q+E C Sbjct: 496 LKKLCPQEEAC 506 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 20.6 bits (41), Expect = 10.0 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -1 Query: 123 HCFTNGVIH 97 HC NGV+H Sbjct: 24 HCHHNGVVH 32 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,806 Number of Sequences: 438 Number of extensions: 3427 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -