BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30451 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Ma... 98 6e-22 SPBPB7E8.02 |||PSP1 family protein|Schizosaccharomyces pombe|chr... 29 0.41 SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc... 25 5.1 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 25 8.9 >SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 98.3 bits (234), Expect = 6e-22 Identities = 47/127 (37%), Positives = 72/127 (56%), Gaps = 1/127 (0%) Frame = +1 Query: 67 MSWQDYVDKQLMASRCVTKAAIAGHDGN-VWAKSEGFEISKDEVAKIVAGFENESLLTSG 243 MSWQ YVD L+ + + +AAI G+ VWA S GF +S E+ + AGF++ + Sbjct: 1 MSWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGT 60 Query: 244 GVTIAGTRYIYLSGTDHIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLGE 423 G+ +AG +YI + I KL K G+ C+ T+ +++S Y E P +AA + E L + Sbjct: 61 GIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALAD 120 Query: 424 YLITCGY 444 YL+ GY Sbjct: 121 YLVGVGY 127 >SPBPB7E8.02 |||PSP1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 749 Score = 29.1 bits (62), Expect = 0.41 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = -2 Query: 290 SVPLR*MYRVPAIVTPPLVSSDSFSKPATIFATSSFEISKPSDFAHTLPS*PAMAAFVTH 111 +VPL Y + T + S SKP+ +S + + P + H++PS ++A ++ Sbjct: 487 NVPLYPAYNSSPVQTRTSLFSSRLSKPSNPIVSSVSQANAPKNALHSMPSPTSLANLPSN 546 Query: 110 L 108 L Sbjct: 547 L 547 >SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 997 Score = 25.4 bits (53), Expect = 5.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 149 MCGQSRKASKFQKMKWRR 202 MC S++ FQK KW R Sbjct: 19 MCNYSKRLDTFQKKKWPR 36 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 24.6 bits (51), Expect = 8.9 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -2 Query: 257 AIVTPPLVSSDSFSKP--ATIFATSSFEISKPSDFAHTLPS*PAM 129 AIVT ++S S S P + +F I KP HTL P + Sbjct: 548 AIVTLSRIASQSTSDPPPSFVFRDDQLVIDKPGFVYHTLNDIPQL 592 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,140,887 Number of Sequences: 5004 Number of extensions: 42475 Number of successful extensions: 109 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -