BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30451 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24515| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 57 1e-08 SB_22107| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_47020| Best HMM Match : Profilin (HMM E-Value=1.8) 32 0.24 SB_20951| Best HMM Match : Pentaxin (HMM E-Value=9.1e-17) 30 0.98 SB_5805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_27836| Best HMM Match : DUF92 (HMM E-Value=2.2e-09) 29 2.3 SB_10315| Best HMM Match : Pentaxin (HMM E-Value=5e-12) 29 3.0 SB_23075| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_47897| Best HMM Match : DUF156 (HMM E-Value=2.9) 27 6.9 SB_46305| Best HMM Match : SSDP (HMM E-Value=2) 27 6.9 SB_16217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 27 9.2 >SB_24515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 58.8 bits (136), Expect = 2e-09 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 4/114 (3%) Frame = +1 Query: 115 VTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAGTRYIYLSGTDH 294 V +AAI G DG+ WA S GF +S+ E +++ ++ S+ TI G +Y+ L Sbjct: 7 VQRAAIHGLDGSCWATSSGFSVSQQEAMELLKSLKDGSV---SAKTIGGAKYMMLRNDQE 63 Query: 295 --IIRAKLGKVGVHCM-KTQQAVVISLYEEPI-QPQQAASVVEKLGEYLITCGY 444 I KL G C+ T+QA+VI YEE +VVE+L +YL GY Sbjct: 64 SKICYLKLKDKGGFCVCLTKQALVIGGYEESAGGAGNCNNVVEQLAQYLKESGY 117 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 56.8 bits (131), Expect = 1e-08 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 2/122 (1%) Frame = +1 Query: 85 VDKQLMASRCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTS-GGVTIAG 261 VD+ L+ + V KA+I G +G +A S GF + E ++A + T GV + Sbjct: 450 VDESLLGTSQVAKASIHGLNGERYASSSGFVVLPSEAQVLIAAITKDPSPTYYKGVCLNR 509 Query: 262 TRYIYLS-GTDHIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLGEYLITC 438 T+Y + H + + G G + T Q ++I Y E + P ++V EKL +Y Sbjct: 510 TKYFVIRVDPGHSLYCRKGNEGAVAVLTSQCLLIGAYSEGMTPGCCSAVTEKLADYFRVN 569 Query: 439 GY 444 G+ Sbjct: 570 GF 571 >SB_22107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 39.1 bits (87), Expect = 0.002 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 14/139 (10%) Frame = +1 Query: 67 MSWQDYVDKQLMASRCVT------KAAIAGHDGNV-WAKSE---GFEISKDEVAKIVAGF 216 MSW Y+D L ++ T KA I G DG W + ++ +E KI F Sbjct: 112 MSWDSYIDNLLAQAKDATGNCHADKACIIGLDGGAPWTSAGHACAVKLQPEECTKIANCF 171 Query: 217 ENESLLT--SGGVTIAGTRYIYLSGTDH--IIRAKLGKVGVHCMKTQQAVVISLYEEPIQ 384 +N+ + S G+ G +Y +L D ++ K + ++ A+VI +E Q Sbjct: 172 KNKDFTSFMSSGIHAEGEKYQFLREEDGKLVLGKKKDHGAITIQASKTALVIGHTKEGGQ 231 Query: 385 PQQAASVVEKLGEYLITCG 441 V + EYL + G Sbjct: 232 QGNTNKAVAVIAEYLESLG 250 >SB_47020| Best HMM Match : Profilin (HMM E-Value=1.8) Length = 404 Score = 32.3 bits (70), Expect = 0.24 Identities = 16/76 (21%), Positives = 32/76 (42%) Frame = +1 Query: 193 VAKIVAGFENESLLTSGGVTIAGTRYIYLSGTDHIIRAKLGKVGVHCMKTQQAVVISLYE 372 ++ +V F + + G+ Y + + K K G+ +KT ++++LY Sbjct: 1 MSSLVGAFGDSARTRMEGLKFEDVLYECVRADKFSVYGKHDKTGIVAIKTATLILVALYS 60 Query: 373 EPIQPQQAASVVEKLG 420 + + P EKLG Sbjct: 61 QEMSPSICVEASEKLG 76 >SB_20951| Best HMM Match : Pentaxin (HMM E-Value=9.1e-17) Length = 179 Score = 30.3 bits (65), Expect = 0.98 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 8/89 (8%) Frame = +1 Query: 79 DYVDKQLMASRCVTKAAIAGHDGN------VWAKSEG-FEISKD-EVAKIVAGFENESLL 234 DY D + ++ T+ IA +DG W + G + + KD VAK G + Sbjct: 37 DYRDVVIYIAQNTTRTGIAVNDGQWHHLCVTWENTAGSWRLYKDGRVAKSGTGLSQGEQI 96 Query: 235 TSGGVTIAGTRYIYLSGTDHIIRAKLGKV 321 GG + G L G H ++ +G++ Sbjct: 97 DGGGAVVLGNEQDMLGGGFHQTQSFIGEM 125 >SB_5805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -1 Query: 354 HSLLCLHAMHADLAKLRADDMVCATEVDVPRARYRHAAT 238 HSL C +A LA +R ++CAT P A RH+ T Sbjct: 71 HSLECTIRCNAPLAVMR-HSLLCATRCHAPLAVMRHSRT 108 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 354 HSLLCLHAMHADLAKLRADDMVCATEVDVPRARYRHA 244 HSLLC +A LA +R ++CA P A RH+ Sbjct: 37 HSLLCATRCYAPLAVMR-HSLLCAIRCYAPLAVMRHS 72 >SB_27836| Best HMM Match : DUF92 (HMM E-Value=2.2e-09) Length = 355 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 88 DKQLMASRCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAGT 264 D LMA + A+A G+ W+ G I K +++ + T+GGVTI GT Sbjct: 174 DASLMAMAVL--GALACSCGDTWSSEIGTAI-KSHTPRLITTLRKVPVGTNGGVTIPGT 229 >SB_10315| Best HMM Match : Pentaxin (HMM E-Value=5e-12) Length = 697 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +1 Query: 139 HDGNVWAKSEGF-EISKDEVAKIV-AGFENESLLTSGGVTIAGTRYIYLSG 285 H G W ++G EI D + ++ GF L +GG + G Y L+G Sbjct: 380 HYGITWRSNDGHVEIHADGILRLSQTGFATGHTLPAGGTMVLGQSYRVLNG 430 >SB_23075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +1 Query: 79 DYVDKQLMASRCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGGVTI 255 D++ +Q+ S C+ A+A G K F + D ++V + ++L TS + I Sbjct: 249 DFIMRQIETSNCLRILALAERHGLKILKEAAFSVIMDNFTEVVETDDFKNLSTSQVIDI 307 >SB_47897| Best HMM Match : DUF156 (HMM E-Value=2.9) Length = 430 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 249 DDSGHAVHLPQWHRPYHPREAWQ-GRR 326 DD+ A P W +P H + AW+ G+R Sbjct: 256 DDTLRARRPPAWRQPVHAKSAWRTGKR 282 >SB_46305| Best HMM Match : SSDP (HMM E-Value=2) Length = 848 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 218 SKPATIFATSSFEISKPSD 162 S P IFA SSF I KPSD Sbjct: 275 SPPLEIFAPSSFFIKKPSD 293 >SB_16217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = -2 Query: 263 VPAIVTPPLVSSDSFSKPATIFATSSFEISKPSDFAHTLPS*PAMAAFVTH 111 VP +PP+ SS KP + A S EIS + S PA A + H Sbjct: 199 VPRSGSPPVSSSRPAQKPTSQTALPSTEISGTGSLPKSTKSRPAPAPPLQH 249 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 418 LTSPRQMRPAEVGWVLHREK*PQLAVSSCNARRPCQ 311 L PR++ + + L R+ P +AV S + PC+ Sbjct: 85 LAGPRRLNASVQAFALLRDNLPNIAVVSARKKSPCE 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,538,805 Number of Sequences: 59808 Number of extensions: 347706 Number of successful extensions: 932 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -