BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30449 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46610| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_50187| Best HMM Match : SAM_1 (HMM E-Value=3.1e-21) 35 0.046 SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_39538| Best HMM Match : VWA (HMM E-Value=0) 29 2.3 SB_27115| Best HMM Match : SAM_1 (HMM E-Value=1.7e-08) 29 3.0 SB_49035| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_39329| Best HMM Match : Metallothio_Pro (HMM E-Value=3.7) 27 9.2 >SB_46610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 51.2 bits (117), Expect = 5e-07 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 7/72 (9%) Frame = +2 Query: 113 MGITRMGDVIAILRHSKQVHENAARDK---VLSNTSVNKVPVAAITGRSTLPQ----PSS 271 MGIT MGD+IAILRH+K+VH + R+K S+ S K P + GR T P+ + Sbjct: 1 MGITVMGDIIAILRHAKEVHAQSEREKAAEAFSSESEVKTP-SRTPGRRTPPELQARKET 59 Query: 272 PASRILEHYTRN 307 PASR+++ + N Sbjct: 60 PASRMVDSWISN 71 >SB_50187| Best HMM Match : SAM_1 (HMM E-Value=3.1e-21) Length = 239 Score = 34.7 bits (76), Expect = 0.046 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = +2 Query: 38 YALTFTENRIQSDMLLDLNKEYLRDMGITRMGDVIAILRHSKQV 169 Y FT++ I+ LL L + L+D+G+T++G + IL KQ+ Sbjct: 162 YCELFTKHDIRGPELLSLTRNDLKDLGVTKVGHIKRILSGVKQL 205 >SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 31.5 bits (68), Expect = 0.43 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +2 Query: 8 AGIPSDVAATYALTFTENRIQSDMLLDLNKEYLRDMGITRMGDVIAI 148 AGI S A Y F +N+I +L + L+ GI MGD I I Sbjct: 37 AGIASADIAKYLAIFEQNKIDDAVLPHMTMAQLQSAGIQAMGDRIKI 83 >SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 31.5 bits (68), Expect = 0.43 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +2 Query: 8 AGIPSDVAATYALTFTENRIQSDMLLDLNKEYLRDMGITRMGDVIAI 148 AGI S A Y F +N+I +L + L+ GI MGD I I Sbjct: 37 AGIASADIAKYLAIFEQNKIDDAVLPHMTMAQLQSAGIQAMGDRIKI 83 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 31.1 bits (67), Expect = 0.56 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = +2 Query: 80 LLDLNKEYLRDMGITRMGDVIAILRHSKQVHENAAR 187 +L+ +K + + + + GD++ +L+ KQ+HEN AR Sbjct: 135 VLESSKRFYLVLELAQNGDLLQLLQKKKQLHENEAR 170 >SB_39538| Best HMM Match : VWA (HMM E-Value=0) Length = 3208 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 362 PNDNIDESEKNLKKARLIRFGSTGLT 439 PND IDE +NL+ A ++ F S GLT Sbjct: 2212 PNDGIDEPARNLRSACVLMF-SLGLT 2236 >SB_27115| Best HMM Match : SAM_1 (HMM E-Value=1.7e-08) Length = 527 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/46 (28%), Positives = 29/46 (63%) Frame = +2 Query: 38 YALTFTENRIQSDMLLDLNKEYLRDMGITRMGDVIAILRHSKQVHE 175 Y F EN+I +L D+++ +L+D + ++ + +AIL+ K +++ Sbjct: 471 YVEVFRENQIDGMLLSDMDETFLKD--VFKVENKLAILKLKKAIND 514 >SB_49035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 516 LVTDSLLPRRENTVCLLDGASLVTSWVSPV 427 LVTDS +P ++T+ + D LVT PV Sbjct: 109 LVTDSTIPVTDSTIPVTDSTILVTDSTIPV 138 >SB_39329| Best HMM Match : Metallothio_Pro (HMM E-Value=3.7) Length = 297 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +2 Query: 53 TENRIQSDMLLDLNKEYLRDMGITRMGDVI---AILRHSKQVHENAARDK 193 ++NR + ++ + + E LR MG+ + GD + A S + + ++DK Sbjct: 20 SQNRCRISLVCNADDEMLRSMGLVKAGDRLNLKAFCESSNKPEKEGSKDK 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,765,727 Number of Sequences: 59808 Number of extensions: 311998 Number of successful extensions: 751 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -