BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30449 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 4.6 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 4.6 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 350 KAVQPNDNIDESEKNLKKARLIRFGSTGLTQ 442 K V+PND++ + KA ++R T L Q Sbjct: 156 KPVEPNDSVALDNQRKMKALILRNVCTSLKQ 186 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.4 bits (48), Expect = 4.6 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 4/98 (4%) Frame = +2 Query: 14 IPSDV--AATYALTFTENRIQSDMLLDLNKEYLRDMG--ITRMGDVIAILRHSKQVHENA 181 IPS V A T ++ L L EY+R + + G + + +Q+ +A Sbjct: 128 IPSTVVTALTNGARGANKKLSKVDTLRLAVEYIRSLQRMLDENGGELPSNKQQQQL-TSA 186 Query: 182 ARDKVLSNTSVNKVPVAAITGRSTLPQPSSPASRILEH 295 + LSN+S+ + T T+ +PS+ +S H Sbjct: 187 SSSNQLSNSSLCSASSGSSTYYGTMSEPSNASSPAPSH 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,532 Number of Sequences: 2352 Number of extensions: 10632 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -