BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30448 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P03747 Cluster: Tail tubular protein B; n=9; T7-like vi... 33 5.1 UniRef50_Q59MN1 Cluster: Putative uncharacterized protein; n=1; ... 32 6.8 >UniRef50_P03747 Cluster: Tail tubular protein B; n=9; T7-like viruses|Rep: Tail tubular protein B - Bacteriophage T7 Length = 794 Score = 32.7 bits (71), Expect = 5.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 6 DGKGQSKHLQXNPRREMSFERSPWCDFVGVNINDVY 113 DG K L+ +P+ + +PW FVG +INDV+ Sbjct: 317 DGNFDFKWLEWSPKSCGDVDTNPWPSFVGSSINDVF 352 >UniRef50_Q59MN1 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 107 Score = 32.3 bits (70), Expect = 6.8 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -1 Query: 486 LTSFILNNKIKCNIQIKSQFEWCLAL-VTLKILF 388 +T++ +N CNI +K +F W L + V++KILF Sbjct: 72 ITTWFINWNSNCNIFMKRRFNWILVMSVSIKILF 105 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 399,005,861 Number of Sequences: 1657284 Number of extensions: 6413748 Number of successful extensions: 10877 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10875 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -