BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30448 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0322 - 7240125-7241568,7242043-7243253,7245782-7246144,724... 27 6.8 06_03_1488 + 30484904-30485134,30485239-30487159,30487255-304876... 27 6.8 >09_02_0322 - 7240125-7241568,7242043-7243253,7245782-7246144, 7246502-7246522 Length = 1012 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 251 VYSSTYYVRYNPIAVLIRKTKFISRSYLNVSYALYSXXXXXXXXXENNIFN 403 V +T + ++P +++ T F R+Y V Y + + NIFN Sbjct: 189 VDEATLWEAFSPFGEVVKITTFPGRTYAFVQYTTIAAACRAKETLQGNIFN 239 >06_03_1488 + 30484904-30485134,30485239-30487159,30487255-30487691, 30487777-30487983 Length = 931 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 6 DGKGQSKHLQXNPRREMSFERSPWCDFVGVNINDVYN 116 DG S N R S R P CD+V + + YN Sbjct: 771 DGSSYSSPSMMNNARVDSMARRPICDYVFDEVEETYN 807 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,855,313 Number of Sequences: 37544 Number of extensions: 146522 Number of successful extensions: 187 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -