BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30447 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 1.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 1.9 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 2.5 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 2.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.5 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 7.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 7.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.5 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 7.5 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 7.5 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 7.5 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 7.5 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 7.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 7.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 7.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 7.5 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 7.5 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 7.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 10.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 10.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 10.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 10.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 10.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 10.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 10.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 10.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 10.0 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 10.0 AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein ... 21 10.0 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTLERANTVQPTVSPKQNGLARVK 393 +KSRS ++ SN+ SKT+ +N + L ++K Sbjct: 80 SKSRSPDSRDRSNTSNTSKTIILSNKGPEGIQINATELQKIK 121 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTLERANTVQ 351 +KSRS ++ SN+ SKT+ +N ++ Sbjct: 80 SKSRSPDSRDRSNTSNTSKTIILSNKLE 107 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTLERANTVQPTVSPKQNGLARVK 393 +KSRS ++ SN+ SKT+ +N + L ++K Sbjct: 80 SKSRSPDSRDRSNTSNTSKTVILSNKGPEGIQINATELQKIK 121 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTLERANTVQ 351 +KSRS ++ SN+ SKT+ +N ++ Sbjct: 80 SKSRSPDSRDRSNTSNTSKTVILSNKLE 107 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDKSNTSNTSKTI 100 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNTSNTSKTV 100 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNTSNTSKTV 100 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNTSNTSKTV 100 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPGSRDRSNTSNTSKTV 100 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKT 327 TKS+S ++ SN+ SKT Sbjct: 85 TKSKSPESRDRSNTSNTSKT 104 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNASNTSKTV 100 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTL 330 +KSRS ++ SN+ SKT+ Sbjct: 80 SKSRSPDSRDRSNTSNTSKTV 100 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 217 PPQHFDLVAE 188 PP+ FDLVAE Sbjct: 31 PPEVFDLVAE 40 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 217 PPQHFDLVAE 188 PP+ FDLVAE Sbjct: 31 PPEVFDLVAE 40 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 268 TKSRSYSKQEHSNSGARSKTLERANTVQ 351 +KSRS ++ S++ SKT+ +N ++ Sbjct: 80 SKSRSPDSRDRSSTSNTSKTVILSNKLE 107 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKT 327 R+A + + +KSRS + SN+ SKT Sbjct: 66 RRAREKKLSKRSKSRSPESRGRSNASNTSKT 96 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 20.6 bits (41), Expect = 10.0 Identities = 10/47 (21%), Positives = 21/47 (44%) Frame = +1 Query: 235 RKAVAESKANFTKSRSYSKQEHSNSGARSKTLERANTVQPTVSPKQN 375 +K + + N+ + YSK SNS ++ + T++ K + Sbjct: 128 QKFIFPQENNYNDNYFYSKSNGSNSSNSDVLFKQNKEEEQTINRKNS 174 >AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein protein. Length = 87 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 259 PSIPQRPSSFSPAPPPQHFD 200 P + P F P PPP + D Sbjct: 42 PRSNRGPVLFPPGPPPNNED 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,165 Number of Sequences: 438 Number of extensions: 2486 Number of successful extensions: 37 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -