BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30446 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila... 28 4.3 At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila... 28 4.3 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 28 4.3 At1g73990.1 68414.m08569 peptidase U7 family protein similar to ... 27 7.5 At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:4... 27 7.5 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 27 7.5 At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR... 27 9.9 >At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 452 DQYFKVILEKKKKKTRG 502 D+YF + EKKKKKT G Sbjct: 158 DKYFGKVAEKKKKKTEG 174 >At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 452 DQYFKVILEKKKKKTRG 502 D+YF + EKKKKKT G Sbjct: 158 DKYFGKVAEKKKKKTEG 174 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 452 DQYFKVILEKKKKKTRG 502 D+YF + EKKKKKT G Sbjct: 158 DKYFGKVAEKKKKKTEG 174 >At1g73990.1 68414.m08569 peptidase U7 family protein similar to protease IV GB:AAA57008 from [Escherichia coli]; contains Pfam profile PF01343: Peptidase family U7 Length = 677 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +1 Query: 208 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVG 360 +I +DVA G +Y+ N I+AE ++G + YE +G Sbjct: 450 VIASMSDVAASGGYYMAMAANAIVAENLTLTGSIGVVTARFTLAKLYEKIG 500 >At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:433663 from [Arabidopsis thaliana] Length = 1529 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 262 TENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVD 387 TE ++L E+ K+E + E EG+K E D T + D Sbjct: 966 TETQVLVEDTQKIEALTEEVEGLKANLEQEKQRADDATRKFD 1007 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -1 Query: 168 HLAGNVCGCDHLAGNVCGCDWHGNGRLHDGQGNNAGSLVSITKVFAEVL 22 H G CG H G GC G G G G + G + S V A L Sbjct: 781 HHGGGGCGGGHHGGGGGGCGGCGGGGC--GGGGDGGGMTSRAVVAASTL 827 >At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1179 Score = 26.6 bits (56), Expect = 9.9 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = -1 Query: 444 DLLR---DVSSVSNETVFVS-SVVYSVGDTVGANVFVESLDLDAFVFGANVLDLAGFFSE 277 D+LR D +S++ VF+ + + GD VES D +A + + DLA F Sbjct: 445 DVLRVSYDELGLSHKDVFLDVACFFRSGDEYYVRCLVESCDTEAIDTVSEIKDLASKFLI 504 Query: 276 NLVLGLVQV 250 N+ G V++ Sbjct: 505 NISGGRVEM 513 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,552,323 Number of Sequences: 28952 Number of extensions: 171114 Number of successful extensions: 546 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -