BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30435 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.05 |cob1|cob|cytochrome b, Cob1|Schizosaccharomyces pombe|... 27 2.2 SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 B... 26 3.8 SPBPB8B6.06c ||SPAPB8B6.06c, SPAPB8B6.06c|conserved fungal prote... 25 5.1 SPAC977.11 |||conserved fungal protein|Schizosaccharomyces pombe... 25 5.1 SPCC777.04 |||amino acid transporter |Schizosaccharomyces pombe|... 25 6.7 >SPMIT.05 |cob1|cob|cytochrome b, Cob1|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 387 Score = 26.6 bits (56), Expect = 2.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 197 AKMRQILMRIYYILSTFVKIHRFLIEINMM 286 A M +I M YY++ + I FLI IN M Sbjct: 214 ANMDRIPMNPYYLIKDLITIFIFLIGINYM 243 >SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 Brl1|Schizosaccharomyces pombe|chr 3|||Manual Length = 692 Score = 25.8 bits (54), Expect = 3.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 464 TIETSLVLIFNFKQMKIGKKKLKY*TNLF 378 T+E+SL I N + + K++++Y NLF Sbjct: 352 TLESSLTQIRNERDSLVAKQQMQYTNNLF 380 >SPBPB8B6.06c ||SPAPB8B6.06c, SPAPB8B6.06c|conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 311 Score = 25.4 bits (53), Expect = 5.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 105 KNGICSILVNQTFFCNELH 161 +NG C++L + F NELH Sbjct: 254 QNGFCAVLSTLSTFSNELH 272 >SPAC977.11 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 311 Score = 25.4 bits (53), Expect = 5.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 105 KNGICSILVNQTFFCNELH 161 +NG C++L + F NELH Sbjct: 254 QNGFCAVLSTLSTFSNELH 272 >SPCC777.04 |||amino acid transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 25.0 bits (52), Expect = 6.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 360 YLNLIQTLLISLINGYYYYIH 298 Y +LI T LI+ NGY +IH Sbjct: 459 YASLIFTGLITFFNGYNAFIH 479 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,884,016 Number of Sequences: 5004 Number of extensions: 34978 Number of successful extensions: 49 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -