BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30432 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25090.1 68418.m02973 plastocyanin-like domain-containing pro... 31 0.46 At3g43800.1 68416.m04681 glutathione S-transferase, putative glu... 29 1.9 At2g25060.1 68415.m02997 plastocyanin-like domain-containing pro... 27 9.9 >At5g25090.1 68418.m02973 plastocyanin-like domain-containing protein Length = 186 Score = 31.1 bits (67), Expect = 0.46 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 508 VVKRRPVNCNTTHYRANWVPGPPSRRCGKRGPNSSAAGKRRDC 380 V K +NCNTT+ AN+ G + + GP +G + +C Sbjct: 74 VTKDAYINCNTTNPAANYSNGDTKVKLERSGPYFFISGSKSNC 116 >At3g43800.1 68416.m04681 glutathione S-transferase, putative glutathione transferase, papaya, PIR:T09781 Length = 227 Score = 29.1 bits (62), Expect = 1.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +1 Query: 85 KLMDWLQNCRTRPA 126 KLMDW++ C TRPA Sbjct: 186 KLMDWIRKCLTRPA 199 >At2g25060.1 68415.m02997 plastocyanin-like domain-containing protein Length = 182 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 511 DVVKRRPVNCNTTHYRANWVPGPPSRRCGKRGPNSSAAGKRRDC 380 +V K +CNTT+ AN+ G + + GP +G C Sbjct: 78 EVTKEAYNSCNTTNPLANYTDGETKVKLDRSGPFYFISGANGHC 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,905,386 Number of Sequences: 28952 Number of extensions: 96254 Number of successful extensions: 250 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -