BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30430 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44100.1 68415.m05484 Rab GDP dissociation inhibitor (GDI1) i... 190 4e-49 At3g59920.1 68416.m06687 Rab GDP dissociation inhibitor (GDI2) i... 188 2e-48 At5g09550.1 68418.m01106 Rab GDP dissociation inhibitor, putativ... 99 9e-22 At3g06540.1 68416.m00758 GDP dissociation inhibitor family prote... 52 3e-07 At4g19380.1 68417.m02853 alcohol oxidase-related similar to long... 33 0.11 At3g23410.1 68416.m02951 alcohol oxidase-related similar to long... 30 1.1 At1g06820.1 68414.m00727 carotenoid isomerase, putative similar ... 29 2.5 At5g24155.1 68418.m02841 squalene monooxygenase, putative / squa... 28 3.2 At1g79020.1 68414.m09214 transcription factor-related similar to... 28 3.2 At5g04340.1 68418.m00426 zinc finger (C2H2 type) family protein ... 28 4.3 At4g36070.1 68417.m05135 calcium-dependent protein kinase family... 28 4.3 At4g31650.1 68417.m04495 transcriptional factor B3 family protei... 27 7.5 At3g62010.1 68416.m06964 expressed protein 27 7.5 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 27 7.5 >At2g44100.1 68415.m05484 Rab GDP dissociation inhibitor (GDI1) identical to GDP dissociation inhibitor [Arabidopsis thaliana] GI:1655424 Length = 445 Score = 190 bits (464), Expect = 4e-49 Identities = 92/149 (61%), Positives = 113/149 (75%), Gaps = 1/149 (0%) Frame = +1 Query: 73 MDEEYDVIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAPA 252 MDEEY+VIVLGTGLKECILSG+LSV G KVLH+DRN YYGGES S+ L +L+ KF Sbjct: 1 MDEEYEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLN-LNQLWKKFRGEE 59 Query: 253 PDETY-GRGRDWNVDLIPKFLMANGLLVKLLIHTGVTRYLEFKSIEGSYVYKGGKISKVP 429 + G RD+NVD++PKF+MANG LV++LIHT VT+YL FK+++GSYV+ GK+ KVP Sbjct: 60 KAPAHLGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVP 119 Query: 430 VDQKEALASDLMGMFEKRRFRNFLIYVQD 516 EAL S LMG+FEKRR F YVQ+ Sbjct: 120 ATPMEALKSPLMGIFEKRRAGKFFSYVQE 148 >At3g59920.1 68416.m06687 Rab GDP dissociation inhibitor (GDI2) identical to Rab GDP dissociation inhibitor AtGDI2 [Arabidopsis thaliana] GI:2446981 Length = 444 Score = 188 bits (458), Expect = 2e-48 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 2/150 (1%) Frame = +1 Query: 73 MDEEYDVIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAP- 249 MDEEY+VIVLGTGLKECILSG+LSV G KVLH+DRN YYGGES S+ L +L+ KF Sbjct: 1 MDEEYEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLN-LNQLWKKFRGEE 59 Query: 250 -APDETYGRGRDWNVDLIPKFLMANGLLVKLLIHTGVTRYLEFKSIEGSYVYKGGKISKV 426 AP E G RD+NVD++PKF+M NG LV+ LIHT VT+YL FK+++GSYV+ GK+ KV Sbjct: 60 KAP-EHLGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKV 118 Query: 427 PVDQKEALASDLMGMFEKRRFRNFLIYVQD 516 P EAL S LMG+FEKRR F +VQ+ Sbjct: 119 PATPMEALKSSLMGIFEKRRAGKFFSFVQE 148 >At5g09550.1 68418.m01106 Rab GDP dissociation inhibitor, putative strong similarity to GDP dissociation inhibitor protein OsGDI1 [Oryza sativa] GI:2384758; contains Pfam profile PF00996: GDP dissociation inhibitor Length = 365 Score = 99 bits (238), Expect = 9e-22 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = +1 Query: 313 MANGLLVKLLIHTGVTRYLEFKSIEGSYVYKGGKISKVPVDQKEALASDLMGMFEKRRFR 492 MANGLLV+ LIHT VT+YL FK+++GS+VYK GKI KVP EAL S LMG+FEKRR R Sbjct: 1 MANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRAR 60 Query: 493 NFLIYVQD 516 F IYVQD Sbjct: 61 KFFIYVQD 68 >At3g06540.1 68416.m00758 GDP dissociation inhibitor family protein / Rab GTPase activator family protein similar to SP|P26374 Rab proteins geranylgeranyltransferase component A 2 (Rab escort protein 2) {Homo sapiens}; contains Pfam profile PF00996: GDP dissociation inhibitor Length = 563 Score = 51.6 bits (118), Expect = 3e-07 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +1 Query: 46 IELIFYTIIMDEEYDVIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASIT-PLE 222 I++ Y + YD+IV+GTG+ E +L+ S SG VLH+D N +YG AS++ P Sbjct: 2 IDIPPYPPLDPSNYDLIVVGTGVSESVLAAAASSSGSSVLHLDPNPFYGSHFASLSLPDL 61 Query: 223 ELFAKFNAPAP 255 F N+ +P Sbjct: 62 TSFLHSNSVSP 72 Score = 42.7 bits (96), Expect = 1e-04 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 3/82 (3%) Frame = +1 Query: 277 RDWNVDLI-PKFLMANGLLVKLLIHTGVTRYLEFKSIEGSYV-YKGGKISKVPVDQKEAL 450 R +NVDL P+ + + L++ +G Y+EFKSI+ S+V G++ VP D + A+ Sbjct: 118 RRFNVDLAGPRVVFCADESINLMLKSGANNYVEFKSIDASFVGDSSGELRNVP-DSRAAI 176 Query: 451 ASD-LMGMFEKRRFRNFLIYVQ 513 D + + EK + F VQ Sbjct: 177 FKDKSLTLLEKNQLMKFFKLVQ 198 >At4g19380.1 68417.m02853 alcohol oxidase-related similar to long chain fatty alcohol oxidase from Candida cloacae [GI:6983581], Candida tropicalis [GI:6983594] Length = 726 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 70 IMDEEYDVIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASI 210 +M + D +V+G+G + +G+L+ +G KVL I+ YY S+ Sbjct: 219 VMKIQCDAVVVGSGSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSL 265 >At3g23410.1 68416.m02951 alcohol oxidase-related similar to long chain fatty alcohol oxidase from Candida cloacae [GI:6983581], Candida tropicalis [GI:6983594] Length = 746 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +1 Query: 88 DVIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAPAPDETY 267 DV+V+G+G + + +L+ SG KV+ +++ Y+ TP E F P D+ Y Sbjct: 234 DVVVVGSGSGGGVAASVLAKSGLKVVVLEKGSYF-------TPSEH--RPFEGPGLDKLY 284 Query: 268 GRG 276 G Sbjct: 285 ENG 287 >At1g06820.1 68414.m00727 carotenoid isomerase, putative similar to carotenoid isomerase from Lycopersicon esculentum [gi:19550437]; contains Pfam profile: PF02032 Phytoene dehydrogenase related enzyme Length = 595 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 85 YDVIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGES 201 YD IV+G+G+ + + L+V +VL +++ GG S Sbjct: 78 YDAIVIGSGIGGLVAATQLAVKEARVLVLEKYLIPGGSS 116 >At5g24155.1 68418.m02841 squalene monooxygenase, putative / squalene epoxidase, putative similar to SP|O65404 (SE 1,1), SP|O65402 (SE 1,2) Length = 121 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 76 DEEYDVIVLGTGLKECILSGMLSVSGKKVLHIDRN 180 D DVI++G G+ L+ L+ G++VL I+R+ Sbjct: 45 DSAADVIIVGAGVGGSALAYSLAKDGRRVLAIERD 79 >At1g79020.1 68414.m09214 transcription factor-related similar to enhancer of polycomb (GI:3757890) [Drosophila melanogaster]; similar to enhancer of polycomb (GI:11907923) [Homo sapiens] Length = 453 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 513 LNVD*EVAETPLLKHAHKIRRKSFFLIDRYFGDFS-TFVNITSF 385 + VD EVA P K A +I F ++D Y D+S TF S+ Sbjct: 47 VEVDNEVAPVPSKKPASEIPTPQFVIVDTYERDYSPTFGQPASY 90 >At5g04340.1 68418.m00426 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 238 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 142 SVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAPAPDETYGRGRDWNVDLIPKFLMAN 321 ++ G K H + K GG S+S++ E++ + + + RG D N+ IP+F M N Sbjct: 162 ALGGHKRCHYE-GKNGGGVSSSVSNSEDVGSTSHVSSGH----RGFDLNIPPIPEFSMVN 216 Query: 322 G 324 G Sbjct: 217 G 217 >At4g36070.1 68417.m05135 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 536 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 316 ANGLLVKLLIHTGVTRYLEFKSIEGSYVYKGGKISKVPVD 435 A + KLL+ R +++ S+V +GG+ S+VP+D Sbjct: 301 AKDFVKKLLVKEPRARLTAAQALSHSWVKEGGEASEVPID 340 >At4g31650.1 68417.m04495 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 493 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +1 Query: 64 TIIMDEEYDVIVLGTGLKE 120 T++MD+ Y +VLG+GL+E Sbjct: 439 TLLMDKRYTRMVLGSGLRE 457 >At3g62010.1 68416.m06964 expressed protein Length = 1254 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = +1 Query: 100 LGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAPAPDETYGRGR 279 L T LKE IL+ + G+ +LH + +S I E + + N P E Y + Sbjct: 989 LETRLKEDILAEVRETGGRMLLHREEYSPASNQSRVIGYWENIQPE-NVKTPAEVYAALK 1047 Query: 280 DWNVDL 297 D N ++ Sbjct: 1048 DENYNI 1053 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 178 NKYYGGESASITPLEELFAKFNAPAPD 258 N +GGE I+ LEEL A PA D Sbjct: 621 NMEFGGEVEEISSLEELKAALTRPASD 647 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,343,543 Number of Sequences: 28952 Number of extensions: 244477 Number of successful extensions: 693 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -