BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30428 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47500.1 68415.m05929 kinesin motor protein-related 48 5e-06 At5g27000.1 68418.m03221 kinesin motor protein-related non-conse... 47 7e-06 At5g41310.1 68418.m05020 kinesin motor protein-related 44 5e-05 At1g63640.2 68414.m07198 kinesin motor protein-related C-termina... 43 1e-04 At1g63640.1 68414.m07197 kinesin motor protein-related C-termina... 43 1e-04 At3g10310.1 68416.m01237 kinesin motor protein-related similar t... 43 1e-04 At1g09170.1 68414.m01024 kinesin motor protein-related similar t... 40 0.001 At3g44730.1 68416.m04814 kinesin motor protein-related similar t... 36 0.021 At5g35700.1 68418.m04269 fimbrin-like protein, putative similar ... 35 0.037 At5g48460.1 68418.m05992 fimbrin-like protein, putative strong s... 34 0.049 At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical t... 34 0.065 At5g55400.1 68418.m06902 fimbrin-like protein, putative similar ... 33 0.086 At2g04750.1 68415.m00485 fimbrin-like protein, putative similar ... 33 0.15 At5g62240.1 68418.m07815 expressed protein various predicted pro... 31 0.35 At5g25475.2 68418.m03031 expressed protein 31 0.46 At5g25475.1 68418.m03030 expressed protein 31 0.46 At3g59100.1 68416.m06589 glycosyl transferase family 48 protein ... 31 0.46 At3g11170.1 68416.m01355 omega-3 fatty acid desaturase, chloropl... 30 1.1 At5g25470.2 68418.m03029 expressed protein 29 1.4 At5g25470.1 68418.m03028 expressed protein 29 1.4 At2g25730.1 68415.m03084 expressed protein 29 1.9 At3g07070.1 68416.m00840 protein kinase family protein contains ... 29 2.5 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 29 2.5 At2g31010.1 68415.m03781 protein kinase family protein contains ... 29 2.5 At2g45600.1 68415.m05670 expressed protein low similarity to PrM... 28 3.2 At2g17010.1 68415.m01961 mechanosensitive ion channel domain-con... 28 4.3 At5g51420.1 68418.m06375 long-chain-alcohol O-fatty-acyltransfer... 27 7.5 At3g48710.1 68416.m05319 expressed protein putative protein - Ar... 27 7.5 At3g04450.1 68416.m00472 myb family transcription factor contain... 27 7.5 At1g72300.1 68414.m08358 leucine-rich repeat transmembrane prote... 27 7.5 At1g51150.1 68414.m05750 DegP protease family contains similarit... 27 9.9 >At2g47500.1 68415.m05929 kinesin motor protein-related Length = 974 Score = 47.6 bits (108), Expect = 5e-06 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 12/101 (11%) Frame = +3 Query: 99 DVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN------------FQLME 242 D+ EP G LR G+ILCK+ NK+ PG+V K+ E + FQ E Sbjct: 65 DLPAEPTEEGLRLG-LRSGIILCKVLNKVQPGAVSKVVESPCDAILVADGAPLSAFQYFE 123 Query: 243 NIQRFQAAIKKYGVPEEEIFQTADPFERRNIPQVTLCLYAL 365 N++ F AI++ G P F+ +D + N +V C+ A+ Sbjct: 124 NVRNFLVAIQEMGFP---TFEASDLEQGGNASRVVNCVLAI 161 >At5g27000.1 68418.m03221 kinesin motor protein-related non-consensus AT donor splice site at exon 12; non-consensus AC acceptor splice site at exon 13 Length = 987 Score = 47.2 bits (107), Expect = 7e-06 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 17/113 (15%) Frame = +3 Query: 78 EVLTWISDVLG----EPLPNGAYEDV----LRDGVILCKLANKLAPGSVKKIQERGTN-- 227 E W+ D++G + P E+ LR G++LC + NK+ PGSV K+ E + Sbjct: 49 EAAGWLRDMIGVSNGKDFPGEPSEEEFRLGLRSGIVLCNVLNKVNPGSVSKVVEAPDDVA 108 Query: 228 -------FQLMENIQRFQAAIKKYGVPEEEIFQTADPFERRNIPQVTLCLYAL 365 FQ ENI+ F AI++ G+P F+ +D + ++ C+ AL Sbjct: 109 DGAALSAFQYFENIRNFLVAIEEMGLPS---FEASDMEKGGKSIRIVNCILAL 158 >At5g41310.1 68418.m05020 kinesin motor protein-related Length = 961 Score = 44.4 bits (100), Expect = 5e-05 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 6/85 (7%) Frame = +3 Query: 60 NKDQEQEVLTWISDVLGE-PLPNGAYEDVLR----DGVILCKLANKLAPGSVKKIQERGT 224 NK Q ++ W+++ L LP A E+ LR DG +LC L N+L+PGS++ G Sbjct: 39 NKQGHQSLVEWLNETLPYLNLPWEASEEELRACLVDGTVLCNLLNQLSPGSMR----MGG 94 Query: 225 NFQL-MENIQRFQAAIKKYGVPEEE 296 +F+ NI+RF AA+ + +P E Sbjct: 95 SFEPGCVNIERFLAAMDEMTLPRFE 119 >At1g63640.2 68414.m07198 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1065 Score = 43.2 bits (97), Expect = 1e-04 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +3 Query: 60 NKDQEQEVLTWISDVLGE-PLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGT 224 +K Q ++ W+++ L LP A ED LRDG +LC L N+L+PGS++ G Sbjct: 38 SKKGHQSLVEWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSMR----MGG 93 Query: 225 NFQ-LMENIQRFQAAIKKYGVPEEEI 299 +F+ I+RF A+ + +P E+ Sbjct: 94 SFEPASVKIERFLTAMDEMALPRFEV 119 >At1g63640.1 68414.m07197 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1064 Score = 43.2 bits (97), Expect = 1e-04 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +3 Query: 60 NKDQEQEVLTWISDVLGE-PLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGT 224 +K Q ++ W+++ L LP A ED LRDG +LC L N+L+PGS++ G Sbjct: 38 SKKGHQSLVEWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSMR----MGG 93 Query: 225 NFQ-LMENIQRFQAAIKKYGVPEEEI 299 +F+ I+RF A+ + +P E+ Sbjct: 94 SFEPASVKIERFLTAMDEMALPRFEV 119 >At3g10310.1 68416.m01237 kinesin motor protein-related similar to carboxy-terminal kinesin 2 GB:P79955 [Xenopus laevis] Length = 897 Score = 42.7 bits (96), Expect = 1e-04 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 16/112 (14%) Frame = +3 Query: 78 EVLTWISDVLGE-PLPNGAYE----DVLRDGVILCKLANKLAPGSVKKIQERGT------ 224 + + W+ V+G+ +PN E LR+G+ILC NK+ PG+V K+ E + Sbjct: 24 QAVQWLKSVVGQLGIPNQPSEKEFISCLRNGMILCNAINKIHPGAVSKVVENYSYLNGEY 83 Query: 225 ----NFQLMENIQRFQAAIKKYGVPEEEIFQ-TADPFERRNIPQVTLCLYAL 365 +Q EN++ F A++ +P E D E ++ +V C+ L Sbjct: 84 QLPPAYQYFENVRNFLVALETLRLPGFEASDLEKDNLESGSVTKVVDCILGL 135 >At1g09170.1 68414.m01024 kinesin motor protein-related similar to GB:AAB61066 Length = 1010 Score = 39.5 bits (88), Expect = 0.001 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 20/94 (21%) Frame = +3 Query: 78 EVLTWISDVLG----EPLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGTN-- 227 E W+ + LG LP E+ LR G++LC + N++ PG+V K+ E + Sbjct: 59 EAARWVRNTLGVVGGRDLPADPSEEDFRIALRSGILLCNVLNRVKPGAVPKVVEAPNDPL 118 Query: 228 ----------FQLMENIQRFQAAIKKYGVPEEEI 299 FQ EN++ F +++ G+P E+ Sbjct: 119 VNQDGAALSAFQYFENLRNFLVFVEEMGIPTFEV 152 >At3g44730.1 68416.m04814 kinesin motor protein-related similar to 4 other kinesin-like proteins of A. thaliana: F02P16.12 (PID:g2191180), katA (D11371), katB (D21137), and katC (D21138); contains non-consensus AT-AC splice sites at intron 10 Length = 1087 Score = 35.5 bits (78), Expect = 0.021 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +3 Query: 111 EPLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQE 215 E LP ED LR+G+ILC + NK+ PGSV K+ E Sbjct: 7 ETLPEKPSEDEFSLALRNGLILCNVLNKVNPGSVLKVVE 45 >At5g35700.1 68418.m04269 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893, fimbrin [Schizosaccharomyces pombe] GI:3057144; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 687 Score = 34.7 bits (76), Expect = 0.037 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +3 Query: 111 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN 227 +P N A+ D+++DGV+LCKL N PG+ I ER N Sbjct: 149 DPATN-AFFDLVKDGVLLCKLINVAVPGT---IDERAIN 183 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 90 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 200 WI+ + N +ED LR+G +L ++ +K++PGSV Sbjct: 401 WINSLGTATYVNNVFED-LRNGWVLLEVLDKVSPGSV 436 >At5g48460.1 68418.m05992 fimbrin-like protein, putative strong similarity to fimbrin-like protein AtFim2 [Arabidopsis thaliana] GI:2737926; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 654 Score = 34.3 bits (75), Expect = 0.049 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +3 Query: 114 PLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 245 P N +E V +DGV+LCKL N PG+ I ER N + M N Sbjct: 152 PSSNDLFE-VAKDGVLLCKLINVAVPGT---IDERAINTKSMLN 191 Score = 31.9 bits (69), Expect = 0.26 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 69 QEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 200 +E+ WI+ G N +ED LRDG IL + +K++PG V Sbjct: 396 EEKAFRFWINSFDGSVYINNVFED-LRDGWILLQTLDKVSPGIV 438 >At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893 Length = 687 Score = 33.9 bits (74), Expect = 0.065 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 111 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 245 +P N YE +++DGV+LCKL N PG+ I ER N + + N Sbjct: 150 DPHSNQLYE-LVKDGVLLCKLINVAVPGT---IDERAINTKRVLN 190 >At5g55400.1 68418.m06902 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 714 Score = 33.5 bits (73), Expect = 0.086 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 111 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 245 +P N YE +++DGV+LCKL N PG+ I ER N + + N Sbjct: 151 DPDSNDLYE-LVKDGVLLCKLINIAVPGT---IDERAINTKRVLN 191 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 90 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 200 WI+ + E N +EDV R+G IL ++ +K+ PGSV Sbjct: 402 WINSLGIESYVNNVFEDV-RNGWILLEVVDKVYPGSV 437 >At2g04750.1 68415.m00485 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 652 Score = 32.7 bits (71), Expect = 0.15 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +3 Query: 114 PLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN 227 P N + D+++DGV+LCKL N PG+ I ER N Sbjct: 144 PTTNALF-DLVKDGVLLCKLINIAVPGT---IDERAIN 177 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +3 Query: 90 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 200 W++ + + +EDV R+G +L ++ +K++PGSV Sbjct: 397 WMNSLGAVTYVDNVFEDV-RNGWVLLEVLDKVSPGSV 432 >At5g62240.1 68418.m07815 expressed protein various predicted proteins, Arabidopsis thaliana; expression supported by MPSS Length = 366 Score = 31.5 bits (68), Expect = 0.35 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +3 Query: 162 LCKLANKLAPGSVKKIQERGTNFQLMENIQRFQAAIKKYGVPEEEIFQTADPFER 326 L K +AP V K+Q + TN Q E ++ K VP+E +TA+ ER Sbjct: 161 LAKFGENVAPVLVSKLQNQDTNRQKQEAKVAHVSSRAKLTVPKEPNLRTAERSER 215 >At5g25475.2 68418.m03031 expressed protein Length = 282 Score = 31.1 bits (67), Expect = 0.46 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 111 LPKHQRSK*EPLVLGPCFWQALCAGEIW 28 LPK+ K + V PCFW++L G+ W Sbjct: 2 LPKNAIEKIQANVSKPCFWKSLSPGQTW 29 >At5g25475.1 68418.m03030 expressed protein Length = 282 Score = 31.1 bits (67), Expect = 0.46 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 111 LPKHQRSK*EPLVLGPCFWQALCAGEIW 28 LPK+ K + V PCFW++L G+ W Sbjct: 2 LPKNAIEKIQANVSKPCFWKSLSPGQTW 29 >At3g59100.1 68416.m06589 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1934 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -3 Query: 196 DPGANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRTSCSWSLF 59 D A+ N ITP + +G PKT+ ++VRT W+LF Sbjct: 444 DLKADFFLNSDEITPQDERLNQVTYGKSKPKTNFVEVRT--FWNLF 487 >At3g11170.1 68416.m01355 omega-3 fatty acid desaturase, chloroplast (FAD7) (FADD) identical to omega-3 fatty acid desaturase, chloroplast precursor SP:P46310 [Arabidopsis thaliana (Mouse-ear cress)]; identical to Pfam profile PF00487: Fatty acid desaturase; identical to cDNA plastid fatty acid desaturase GI:809491 Length = 446 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -3 Query: 202 FTDPGANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRT--SCSWSL 62 +T P +N L+N + PSLS+SSY S SP + + R + +W+L Sbjct: 18 YTTPRSNFLSNNNKFRPSLSSSSYKT--SSSPLSFGLNSRDGFTRNWAL 64 >At5g25470.2 68418.m03029 expressed protein Length = 280 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 111 LPKHQRSK*EPLVLGPCFWQALCAGEIW 28 LP++ K + V PCFW++L G+ W Sbjct: 2 LPRNATDKIQGNVSKPCFWKSLSPGQNW 29 >At5g25470.1 68418.m03028 expressed protein Length = 280 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 111 LPKHQRSK*EPLVLGPCFWQALCAGEIW 28 LP++ K + V PCFW++L G+ W Sbjct: 2 LPRNATDKIQGNVSKPCFWKSLSPGQNW 29 >At2g25730.1 68415.m03084 expressed protein Length = 2464 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 487 RLSSALWARSCSSVKVRSFLSAI 419 R + LW+RSC S + SFLS I Sbjct: 52 RFDNVLWSRSCPSPSLLSFLSTI 74 >At3g07070.1 68416.m00840 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 414 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +3 Query: 57 RNKDQEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQL 236 R KD EQ ++TW V EP D +GV K N+ + +QE T L Sbjct: 287 RPKD-EQNLVTWAQPVFKEPSRFPELADPSLEGVFPEKALNQAVAVAAMCLQEEATVRPL 345 Query: 237 MENI 248 M ++ Sbjct: 346 MSDV 349 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 140 CAKGRCDPLQIGQQISSWISEKNPRERNQLPAHG 241 C + R L G I S + EK PR+R + PA+G Sbjct: 356 CTEKRPVSLLAGAGIVSVVDEKRPRKRGRKPANG 389 >At2g31010.1 68415.m03781 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 775 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 90 WISDVLGEPLPNGAYEDVLRDGVILCKLANKL-APGSVKKIQERGTNFQLM 239 W + +L EP+PNG Y V+ D + +L N+L P + + E G +++ Sbjct: 57 WDTGILSEPIPNGFY-SVVPDKRVK-ELYNRLPTPSELHALGEEGVRIEVI 105 >At2g45600.1 68415.m05670 expressed protein low similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 21 LETRFRL---HTMPARNKDQEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCK 170 L +RL H +PA +D + +L W+ D P+ G + L+DGV K Sbjct: 103 LSVEYRLAPEHRLPAAYEDAVEAIL-WLRDQARGPINGGDCDTWLKDGVDFSK 154 >At2g17010.1 68415.m01961 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 779 Score = 27.9 bits (59), Expect = 4.3 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%) Frame = +3 Query: 24 ETRFRLH--TMPARNKDQEQEVLTWIS-DVLGEPLPNGAYEDVLRDGVILCKLANKLAPG 194 ETR R++ + A N + +++ +S L E + YED + K A A Sbjct: 406 ETRSRMNHKNISAWNMKRLMKIVRNVSLTTLDEQMLESTYEDESTRQIRSEKEAKAAARK 465 Query: 195 SVKKIQERGTNFQLMENIQRF 257 K +++RG + +E++ RF Sbjct: 466 IFKNVEQRGAKYIYLEDLMRF 486 >At5g51420.1 68418.m06375 long-chain-alcohol O-fatty-acyltransferase family protein / wax synthase family protein contains similarity to wax synthase wax synthase - Simmondsia chinensis, PID:g5020219 similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 435 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -2 Query: 305 LEYFFFWYSVFLDCRLEPLNVLHELEVGSSLLDFF 201 L+ F ++S+ LDC LEP L+E + SL DF+ Sbjct: 170 LKLFNAFFSIALDCELEP--QLNEPYLAYSLRDFW 202 >At3g48710.1 68416.m05319 expressed protein putative protein - Arabidopsis thaliana, EMBL:AL078465.1 Length = 462 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 202 KKSKREEPTSSSWRTFKGSKRQSRNTEYQKKK 297 K++K+E+P + ++ KGS + SR + Q K Sbjct: 307 KRTKKEKPAAEEEKSIKGSAKSSRKSFRQVDK 338 >At3g04450.1 68416.m00472 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 438 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 42 HTMPARNKDQEQEVLTWISD 101 H++ N+ QEQ+++TW SD Sbjct: 113 HSLQLINQPQEQKIMTWSSD 132 >At1g72300.1 68414.m08358 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3641252 from [Malus x domestica] (Plant Mol. Biol. 40 (6), 945-957 (1999)) Length = 1095 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +3 Query: 330 NIPQVTLCLYALGRITQKHPEFTGPQLGPKMADKNERTFTEEQLRAHNAELNLQMGFNKG 509 N+P L L L R+ H +GP ++ ++ + + EL LQ F G Sbjct: 107 NLPSSVLDLQRLSRLDLSHNRLSGPLPPGFLSALDQLLVLDLSYNSFKGELPLQQSFGNG 166 Query: 510 AS 515 ++ Sbjct: 167 SN 168 >At1g51150.1 68414.m05750 DegP protease family contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 219 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 252 RFQAAIKKYGVPEEEIFQTADPFERRNIPQVTLCLYALG 368 R+ + G+ EE ++ +P E IP + +YALG Sbjct: 126 RYGCDLAILGIDSEEFWEDINPLELGGIPFIGETVYALG 164 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,714,384 Number of Sequences: 28952 Number of extensions: 282432 Number of successful extensions: 891 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -