BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30427 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10606| Best HMM Match : I-set (HMM E-Value=0) 31 0.43 SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) 30 0.98 SB_52407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_30376| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_10606| Best HMM Match : I-set (HMM E-Value=0) Length = 872 Score = 31.5 bits (68), Expect = 0.43 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 105 DAFVIVQEAGPVDRTRRPCRSQNCH 31 D +++Q+A PVDR R C ++N H Sbjct: 614 DGSIVIQKASPVDRGRYTCTARNSH 638 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 96 VIVQEAGPVDRTRRPCRSQNCH 31 +++Q+A PVDR R C ++N H Sbjct: 838 IVIQKASPVDRGRYTCTARNSH 859 >SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) Length = 464 Score = 30.3 bits (65), Expect = 0.98 Identities = 22/65 (33%), Positives = 30/65 (46%) Frame = +1 Query: 277 NVRTLKTVLTVDCPWLNFESNRTLAQHMSFKEDVVLSFYINGSYPLIRLTTVFDKGNNFD 456 NV TL+++ T W N A SFKE +VL Y G YP + ++ NN Sbjct: 159 NVTTLRSLYTKS--WSNVPEQFIKAYSASFKETIVLCRY--GLYP-CNMKLFTEQVNNIG 213 Query: 457 LCSAF 471 C +F Sbjct: 214 RCFSF 218 >SB_52407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +3 Query: 66 DLQALLLGRLQMHLRPPGRELEMYPGQRADPLAVRDTGVPV*NTILQRHLHR 221 D+ A + + + LRPPGR P + D + V D+ N++ +R HR Sbjct: 42 DIVAKKMAKNLLRLRPPGRRQYAAPRRPTDVILVVDSS----NSLRRREFHR 89 >SB_30376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 223 HNLITRNHDKCRVSEFYDNV-RTLKTVLTVDCPWLNFESNRTLAQHMS 363 H+L R H+ +YD RTL+ V PW N S L H+S Sbjct: 170 HDLANRGHNW----RYYDETFRTLRQVNPSLFPWANIHSELWLRSHVS 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,344,038 Number of Sequences: 59808 Number of extensions: 326771 Number of successful extensions: 1185 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1185 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -