BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30427 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-16|AAK68571.2| 347|Caenorhabditis elegans Hypothetical... 29 2.0 Z82068-2|CAB04898.2| 233|Caenorhabditis elegans Hypothetical pr... 28 3.4 Z81086-3|CAD56586.1| 711|Caenorhabditis elegans Hypothetical pr... 27 6.0 Z81086-2|CAB03121.3| 1045|Caenorhabditis elegans Hypothetical pr... 27 6.0 >AC084158-16|AAK68571.2| 347|Caenorhabditis elegans Hypothetical protein Y69A2AR.26 protein. Length = 347 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 187 TGTPVSRTARGSALCPGYISSSRPGGRRCI 98 + TP S+T+ A+C G SSSR G CI Sbjct: 10 SSTPSSQTSELCAVCGGKASSSRYGALSCI 39 >Z82068-2|CAB04898.2| 233|Caenorhabditis elegans Hypothetical protein W04A4.4 protein. Length = 233 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 241 NHDKCRVSEFYDNVRTLKTVLTVDCPWLNFESNR 342 N+D+ RV EF R K +LTV P + ES + Sbjct: 88 NNDENRVWEFIQENRNSKFILTVSTPTIEEESEK 121 >Z81086-3|CAD56586.1| 711|Caenorhabditis elegans Hypothetical protein F53B6.2b protein. Length = 711 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = -3 Query: 136 YISSSRPGGRRC-ICNRPRS-RACRSD 62 +ISS RP GR C RP S RAC +D Sbjct: 628 WISSGRPAGRNCEQMRRPHSARACVAD 654 >Z81086-2|CAB03121.3| 1045|Caenorhabditis elegans Hypothetical protein F53B6.2a protein. Length = 1045 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = -3 Query: 136 YISSSRPGGRRC-ICNRPRS-RACRSD 62 +ISS RP GR C RP S RAC +D Sbjct: 962 WISSGRPAGRNCEQMRRPHSARACVAD 988 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,840,485 Number of Sequences: 27780 Number of extensions: 243276 Number of successful extensions: 636 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -