BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30427 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 26 0.26 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 26 0.26 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 2.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.3 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 5.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 5.7 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 7.5 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 10.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 10.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 10.0 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 25.8 bits (54), Expect = 0.26 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +1 Query: 199 YFNATYIDHNLITRNHDKCRVSEFYDNVRTLKTVLTVDCPWLNFESNRTLAQHMSFKE 372 YF+ TYI + + H+K ++E + TL+ + + L + TL Q + E Sbjct: 39 YFHHTYIIYESLCGRHEKRLLNELLSSYNTLERPVANESEPLEVKFGITLQQIIDVDE 96 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 25.8 bits (54), Expect = 0.26 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +1 Query: 199 YFNATYIDHNLITRNHDKCRVSEFYDNVRTLKTVLTVDCPWLNFESNRTLAQHMSFKE 372 YF+ TYI + + H+K ++E + TL+ + + L + TL Q + E Sbjct: 39 YFHHTYIIYESLCGRHEKRLLNELLSSYNTLERPVANESEPLEVKFGITLQQIIDVDE 96 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 119 PRTRNVSRAEGRSPRST 169 PRTR V R++GR T Sbjct: 1 PRTRRVKRSDGRGNGGT 17 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 102 AFVIVQEAGPVDRTRRPCRSQNCHSGY 22 A +V ++ +++ ++CHSGY Sbjct: 474 AVAVVSKSSSINKLEDLRNKKSCHSGY 500 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 102 AFVIVQEAGPVDRTRRPCRSQNCHSGY 22 A +V ++ +++ ++CHSGY Sbjct: 474 AVAVVSKSSSINKLEDLRNKKSCHSGY 500 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 102 AFVIVQEAGPVDRTRRPCRSQNCHSGY 22 A +V ++ +++ ++CHSGY Sbjct: 474 AVAVVSKSSSINKLEDLRNKKSCHSGY 500 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = -1 Query: 273 IKFADTAFVVVTGNEIMVDVGGVEVWYFKLEHRYLVLRGD 154 +KF+ F+V+ + M+D+G + ++H +V G+ Sbjct: 343 VKFSSVQFLVLDEADRMLDMGFLPSIEKMVDHETMVPLGE 382 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 181 TPVSRTARGSALCPGYISSSRPGGR 107 TPV R A+ S+ Y S GGR Sbjct: 1339 TPVPRLAQDSSEDESYRGPSASGGR 1363 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 98 NASPTTW 118 NASPTTW Sbjct: 514 NASPTTW 520 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 72 VDRTRRPCRSQNCHS 28 V TRRP R +C S Sbjct: 398 VGSTRRPSRRNSCES 412 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 488 ARSANVKAEHKSK 450 +RS NVK +HKS+ Sbjct: 921 SRSINVKWQHKSQ 933 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 488 ARSANVKAEHKSK 450 +RS NVK +HKS+ Sbjct: 917 SRSINVKWQHKSQ 929 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,496 Number of Sequences: 438 Number of extensions: 3181 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -