BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30413 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54990.1 68416.m06102 AP2 domain-containing transcription fac... 30 1.1 At3g07740.2 68416.m00935 transcriptional adaptor (ADA2a) identic... 29 1.9 At3g07740.1 68416.m00936 transcriptional adaptor (ADA2a) identic... 29 1.9 At5g23910.1 68418.m02808 kinesin motor protein-related 29 2.5 At5g55540.1 68418.m06919 expressed protein 28 3.2 At1g67170.1 68414.m07641 expressed protein similar to enterophil... 28 3.2 At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transfera... 28 3.2 At5g23440.1 68418.m02750 ferredoxin-thioredoxin reductase, putat... 28 4.3 At4g01090.1 68417.m00147 extra-large G-protein-related contains ... 28 4.3 At3g44290.1 68416.m04756 no apical meristem (NAM) family protein... 27 5.7 At3g42070.1 68416.m04317 hypothetical protein 27 7.5 At3g28345.1 68416.m03541 ABC transporter family protein similar ... 27 7.5 At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 ... 27 9.9 At5g02950.1 68418.m00238 PWWP domain-containing protein predicte... 27 9.9 At1g60930.1 68414.m06858 DNA helicase, putative strong similarit... 27 9.9 >At3g54990.1 68416.m06102 AP2 domain-containing transcription factor, putative similar to (SP:P47927) Floral homeotic protein APETALA2, Arabidopsis thaliana, U12546 Length = 247 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 48 YDRYLTEYEH-DIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSRGK 212 YDR ++ D D V + +RHD K + + + + LR S FGR S+ K Sbjct: 161 YDRAAIKFRGLDADINFVVDDYRHDIDKMKNLNKVEFVQTLRRESASFGRGSSKYK 216 >At3g07740.2 68416.m00935 transcriptional adaptor (ADA2a) identical to transcriptional adaptor ADA2a [Arabidopsis thaliana] gi|13591698|gb|AAK31319 Length = 477 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +3 Query: 42 FNYDRYLTEYEHDIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSR 206 +N R E EHD D + + DA E Q L VLR +SKR + R Sbjct: 204 YNLKREEFEIEHDNDAEQLLADMEFKDSDTDA-EREQKLQVLRIYSKRLDERKRR 257 >At3g07740.1 68416.m00936 transcriptional adaptor (ADA2a) identical to transcriptional adaptor ADA2a [Arabidopsis thaliana] gi|13591698|gb|AAK31319 Length = 548 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +3 Query: 42 FNYDRYLTEYEHDIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSR 206 +N R E EHD D + + DA E Q L VLR +SKR + R Sbjct: 275 YNLKREEFEIEHDNDAEQLLADMEFKDSDTDA-EREQKLQVLRIYSKRLDERKRR 328 >At5g23910.1 68418.m02808 kinesin motor protein-related Length = 665 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 272 SRFTTTLSLPLRGLRYPATVTCLSIARSTATPRALSMPTTTLAL 403 S+ T L L+G +TCL++ R T R + T T A+ Sbjct: 261 SKLTRMLKDCLKGSNITLLITCLTVLRGNVTERKTKINTATSAI 304 >At5g55540.1 68418.m06919 expressed protein Length = 1380 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -2 Query: 245 SGKTLRRVGLYLSSALMSSEPFRE----RTKDCQNLA 147 SGKT+ R G L+ L+S + FRE R D NLA Sbjct: 1057 SGKTVLRAGFDLARNLLSDDDFREVLQRRYHDLHNLA 1093 >At1g67170.1 68414.m07641 expressed protein similar to enterophilin-2L (GI:12718845) [Cavia porcellus]; similar to Hyaluronan mediated motility receptor (Intracellular hyaluronic acid binding protein) (Receptor for hyaluronan-mediated motility) (CD168 antigen) (Swiss-Prot:O75330) [Homo sapiens] Length = 359 Score = 28.3 bits (60), Expect = 3.2 Identities = 19/80 (23%), Positives = 33/80 (41%) Frame = +1 Query: 115 MIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRRSVFPELLSTYPYSKSIYDDPI 294 ++ R E SK + Q +S + I A R + + +TY Y K Y+D + Sbjct: 150 VVAREELMSKVHQLTQELQKSRSDVQQIPALMSELENLRQEYQQCRATYDYEKKFYNDHL 209 Query: 295 AAAERITVPGYRYLPVHREI 354 E + Y+ + RE+ Sbjct: 210 ---ESLQAMEKNYMTMAREV 226 >At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose glucosyltransferase GI:453245 from [Manihot esculenta] Length = 479 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -1 Query: 462 GINSTSHASWH---VVDWPVIIERARVVVGIDRARGVAVDLAMD 340 G NST + W V WP+ E+ + + G+AVDL MD Sbjct: 369 GWNSTLESLWFGVPVATWPMYAEQQLNAFTLVKELGLAVDLRMD 412 >At5g23440.1 68418.m02750 ferredoxin-thioredoxin reductase, putative similar to ferredoxin-thioredoxin reductase, variable chain (FTR-V, Ferredoxin- thioredoxin reductase subunit A, FTR-A) [Zea mays] SWISS-PROT:P80680 Length = 182 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +2 Query: 311 LRYPATVTCLSIARSTATPRALSMPTTTLA-LSIITGQS 424 +R P++ CLS + +TAT +++ + +A LS+ T QS Sbjct: 15 IRRPSSHDCLSASATTATATPMALKSCIVAPLSLFTSQS 53 >At4g01090.1 68417.m00147 extra-large G-protein-related contains weak similarity to extra-large G-protein [Arabidopsis thaliana] gi|3201682|gb|AAC19353 Length = 714 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 337 PVHREIYG-YSPRPIYAHNYPRSLDYYRPIY 426 PVH + ++P P Y H YP + Y P++ Sbjct: 116 PVHLHGHANHNPGPSYYHQYPEPIQYPGPVH 146 >At3g44290.1 68416.m04756 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; NAC2 - Arabidopsis thaliana, EMBL:AF201456 Length = 335 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 480 CLVGVEGINSTSHASWHVVDWPVII 406 C +G+ I S + A W VV W +++ Sbjct: 302 CFIGIYSIKSINRARWDVVVWLLVM 326 >At3g42070.1 68416.m04317 hypothetical protein Length = 230 Score = 27.1 bits (57), Expect = 7.5 Identities = 21/94 (22%), Positives = 37/94 (39%) Frame = +1 Query: 154 FWQSFVRSLKGSEDIRAEERYRPTRRSVFPELLSTYPYSKSIYDDPIAAAERITVPGYRY 333 FW F + S+D E P R Y +++ + A +++ + Sbjct: 97 FWSRFGNGIYDSKDAVHSEIRHPVLR---------YLVDRNVNFGSVFAHHLVSLKTKPF 147 Query: 334 LPVHREIYGYSPRPIYAHNYPRSLDYYRPIYHVP 435 H E+ G+ P P H+ PR++ + Y VP Sbjct: 148 TGEHEEL-GFHPDPSLLHSAPRTMKHRALPYQVP 180 >At3g28345.1 68416.m03541 ABC transporter family protein similar to P-glycoprotein [Arabidopsis thaliana] GI:3849833; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1240 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 384 PQLPSLSRLLQANLPRAK 437 PQLPS RLL NLP K Sbjct: 653 PQLPSFKRLLAMNLPEWK 670 >At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 family protein contains Pfam domain PF04153: NOT2 / NOT3 / NOT5 family Length = 843 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 185 VRKTSEPRKGTGQHAAAFFPNSCRPTL 265 V KT P+ G G H+A P RP+L Sbjct: 295 VPKTPPPKNGAGLHSAPSTPAGGRPSL 321 >At5g02950.1 68418.m00238 PWWP domain-containing protein predicted protein, Arabidopsis thaliana Length = 632 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 182 KVRKTSEPRKGTGQHAAAFFPNSCRPTLTPSR 277 K++KT+EP GTG NS PTL P R Sbjct: 394 KLQKTAEPCHGTGVENEM---NSLTPTLKPCR 422 >At1g60930.1 68414.m06858 DNA helicase, putative strong similarity to DNA Helicase recQl4B [Arabidopsis thaliana] GI:11121451; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00570: HRDC domain Length = 1024 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 311 LRYPATVTCLSIARSTATPRALSMPTTTLALS 406 +R+P+T+ ++STA P + + TTL ++ Sbjct: 928 MRFPSTIKVSKQSKSTANPAKVPLKQTTLPMA 959 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,871,685 Number of Sequences: 28952 Number of extensions: 254961 Number of successful extensions: 791 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -