BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30410 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0195 - 19111983-19112477,19112646-19113950,19114053-191143... 27 8.9 >01_05_0195 - 19111983-19112477,19112646-19113950,19114053-19114322, 19118884-19118950,19119229-19119284,19119530-19119590, 19120181-19120297,19120570-19120682,19120774-19120848, 19121464-19122045,19122056-19122271,19122372-19122497, 19126152-19126190,19126266-19126360,19126423-19126962, 19127102-19127327,19127385-19127437,19127534-19127701, 19128353-19128707,19128785-19128876,19129891-19129993 Length = 1717 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +2 Query: 392 MILINFVNLV*KYK--TSFG*YLGTYK*SKYRTACICNKCTVI 514 +++ ++NL KY+ TSFG L + C C KC V+ Sbjct: 514 IVVERYINLFCKYEEATSFGSKLEVSMRLSNKVTCHCGKCVVV 556 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,677,120 Number of Sequences: 37544 Number of extensions: 180900 Number of successful extensions: 267 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -