BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30410 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006777-7|AAK72306.2| 367|Caenorhabditis elegans Seven tm rece... 29 2.6 Z67737-2|CAA91537.3| 400|Caenorhabditis elegans Hypothetical pr... 28 4.6 >AC006777-7|AAK72306.2| 367|Caenorhabditis elegans Seven tm receptor protein 222 protein. Length = 367 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 213 VINKYTRGLI*YLKRH*NKLLCPKNLRTDEKNLS 314 +I Y R L+ YL+ N+ LC K++ +D +N S Sbjct: 309 IIKDYRRALLNYLRWIKNRFLCRKHVVSDVRNAS 342 >Z67737-2|CAA91537.3| 400|Caenorhabditis elegans Hypothetical protein T01H10.2 protein. Length = 400 Score = 27.9 bits (59), Expect = 4.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 516 TITVHLLQIHAVRYFDHLYVPKYY 445 T TV + HA+ Y LYVPKY+ Sbjct: 5 TFTVIFIGSHALYYNPELYVPKYH 28 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,687,244 Number of Sequences: 27780 Number of extensions: 208792 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -