BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30407 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4A7L3 Cluster: Putative uncharacterized protein; n=3; ... 33 5.1 UniRef50_UPI000049A17C Cluster: conserved hypothetical protein; ... 32 6.8 >UniRef50_Q4A7L3 Cluster: Putative uncharacterized protein; n=3; Mycoplasma hyopneumoniae|Rep: Putative uncharacterized protein - Mycoplasma hyopneumoniae (strain 7448) Length = 337 Score = 32.7 bits (71), Expect = 5.1 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +2 Query: 80 IQKYIQSSIFTLLRSTFIFYLLIKNFKIFGQDSHFYFYFIMI 205 I K + ++F +L +TF ++++ NFKIF + Y+ + I Sbjct: 250 IDKNLGLTVFIILEATFFTFMIVLNFKIFREYFESYYKILTI 291 >UniRef50_UPI000049A17C Cluster: conserved hypothetical protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: conserved hypothetical protein - Entamoeba histolytica HM-1:IMSS Length = 198 Score = 32.3 bits (70), Expect = 6.8 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +2 Query: 50 FLISIFL*YNIQKYIQSSIFTLLRSTFIFYL-----LIKNFKIFGQDSHFYFYFIMI 205 FLI +F+ YN K ++ F + +IFYL L+ +F H+YF + + Sbjct: 71 FLIHMFMLYNFSKELEEEYFNNDTTDYIFYLLFNCCLLNILSVFVGPLHYYFISLFV 127 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 366,454,418 Number of Sequences: 1657284 Number of extensions: 5856142 Number of successful extensions: 12764 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12756 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -