BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30407 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 25 0.53 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 2.8 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 2.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.5 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 24.6 bits (51), Expect = 0.53 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 475 IVLQLLYLIAILQPYCGSVHRIKKY*SGW 389 ++L + +I +LQPY + RI Y S W Sbjct: 3 LLLAVATIITLLQPYDATPARIVCYFSNW 31 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 22.2 bits (45), Expect = 2.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 337 IKTYYSNFHSYTFNPYFSIPINIFLFYAQIRNKVA 441 + Y + + S NPY SI + FY+ + N A Sbjct: 7 VGVYGAPYPSTDQNPYPSIGVESSAFYSPLSNPYA 41 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.2 bits (45), Expect = 2.8 Identities = 19/58 (32%), Positives = 27/58 (46%) Frame = +1 Query: 301 KFFILFCHDLK*IKTYYSNFHSYTFNPYFSIPINIFLFYAQIRNKVARWQSNIIIVVR 474 K+FI+ + L I T H FN Y +IF F+A + +A NI+ V R Sbjct: 42 KYFIIAIYVLT-ILTSSVTLH-VCFNSYMYAFTHIFFFFAICCDFIALIVVNIVHVFR 97 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 403 IFLFYAQIRNKVARWQSNIIIVV 471 +FL Q++ WQ IIIV+ Sbjct: 1341 MFLVVGQLQASQIHWQKIIIIVM 1363 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,428 Number of Sequences: 336 Number of extensions: 1975 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -