BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30407 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55717| Best HMM Match : SLEI_Leptospira (HMM E-Value=3.3) 28 5.3 SB_2556| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_55717| Best HMM Match : SLEI_Leptospira (HMM E-Value=3.3) Length = 126 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 50 FLISIFL*YNIQKYIQSSIFTLLRSTFIFYLL 145 FLIS+ + NIQ ++S F L +F+FY L Sbjct: 36 FLISLEMAKNIQTVMKSLFFRRLALSFVFYSL 67 >SB_2556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 301 KFFILFCHDLK*IKTYYSNFHSYT--FNPYFSIPINIFLFY 417 KFF CH + ++ S+ HS++ + Y S I+ F FY Sbjct: 51 KFFASSCHTFENLRRISSDRHSFSRVYYKYLSNRISKFFFY 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,965,330 Number of Sequences: 59808 Number of extensions: 169898 Number of successful extensions: 256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 256 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -