BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30405 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 0.81 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 4.3 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 10.0 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 0.81 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +2 Query: 50 VHLSKQKQTQDKMC-DRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFD 226 +H ++ K+T DK+C + V+ A ++ + +EK + A +KK + Sbjct: 1689 IHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEK----NEAAMKLKKRIE 1744 Query: 227 KKYNP 241 K NP Sbjct: 1745 KGANP 1749 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 21.8 bits (44), Expect = 4.3 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -3 Query: 172 ERLSCTVNSILLHLFAH 122 ER+ C+ NS++ H++ + Sbjct: 42 ERVYCSRNSLMTHIYTY 58 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 256 DAMPGRIVFLVKFFL 212 DA+PGR+ LV L Sbjct: 226 DAIPGRVALLVTSML 240 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,522 Number of Sequences: 438 Number of extensions: 2785 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -