BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30390 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 79 2e-17 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 4.3 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 5.7 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 10.0 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 79.4 bits (187), Expect = 2e-17 Identities = 45/130 (34%), Positives = 63/130 (48%) Frame = +1 Query: 127 ALTTFLAAQCAIAGDHLWPADATDKVLEDPNYDFIXXXXXXXXXXXXNRLSEISDWKVLL 306 AL F A + G+ ++ + D +YDFI RLSE+S+WKVLL Sbjct: 40 ALLNFFVATSPVIGEPCQRVHSSR--IPDLSYDFIVVGGGAARAVVAGRLSEVSNWKVLL 97 Query: 307 XEXGGNPTLATEIPQPYYSNMGTSXDWAYHTEPQEGACRAYKNKGCAWPRGKVLGGSSSX 486 E G + EIP +G DW Y+T + AC + C WPRGK LGG++ Sbjct: 98 LEAGPDEPAGAEIPSNLQLYLGGDLDWKYYTTNESHACLS-TGGSCYWPRGKNLGGTTLH 156 Query: 487 NLMFYVRGNK 516 + M Y RG++ Sbjct: 157 HGMAYHRGHR 166 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 236 SELVPPDRLSPIVLAKYL 289 +E++PP L+ +L KYL Sbjct: 286 AEIIPPTSLTVPLLGKYL 303 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 236 SELVPPDRLSPIVLAKYL 289 +E++PP L+ +L KYL Sbjct: 299 AEIIPPTSLAIPLLGKYL 316 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 403 VQYGKPSLXMSPYYCSKVAVSRLP 332 V Y KPS + K+ + RLP Sbjct: 322 VHYRKPSTHKMAPWVRKIFIRRLP 345 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,144 Number of Sequences: 438 Number of extensions: 2782 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -