BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30383 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 4e-16 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 79 3e-15 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 77 7e-15 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 7e-15 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 76 2e-14 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 75 3e-14 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 2e-13 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 7e-12 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 5e-10 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 7e-09 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 7e-09 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 53 2e-07 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 49 2e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 49 2e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 49 2e-06 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 48 3e-06 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 3e-05 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 42 3e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 42 4e-04 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 41 7e-04 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 41 7e-04 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 40 0.001 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 40 0.001 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0) 40 0.002 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 39 0.003 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 39 0.003 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 39 0.003 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 38 0.004 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 38 0.004 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 38 0.004 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 38 0.004 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 38 0.004 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 38 0.004 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 38 0.004 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 38 0.004 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 38 0.004 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 38 0.004 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 38 0.004 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 38 0.004 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 38 0.004 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 38 0.004 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 38 0.004 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 38 0.004 SB_8442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 38 0.005 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 38 0.005 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 38 0.005 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 38 0.005 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 38 0.005 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) 38 0.005 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 38 0.005 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 38 0.005 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 38 0.005 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) 38 0.005 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 38 0.005 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 38 0.005 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 38 0.005 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 38 0.005 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 38 0.005 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 38 0.005 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 38 0.005 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 38 0.005 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 38 0.005 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 38 0.005 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 38 0.005 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 38 0.005 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 38 0.005 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 38 0.005 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 38 0.005 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 38 0.005 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 38 0.005 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 38 0.005 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 38 0.005 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 38 0.005 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 38 0.005 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 38 0.005 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) 38 0.005 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 38 0.005 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 38 0.005 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 38 0.005 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 38 0.005 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 38 0.005 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) 38 0.005 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 38 0.005 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 38 0.005 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 38 0.005 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 38 0.005 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 38 0.005 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 38 0.005 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 38 0.005 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 38 0.005 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 38 0.005 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 38 0.005 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 38 0.005 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 38 0.005 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 38 0.005 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 38 0.005 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 38 0.005 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 38 0.005 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 38 0.005 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 38 0.005 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 38 0.005 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 38 0.005 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 38 0.005 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 38 0.005 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 38 0.005 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 81.4 bits (192), Expect = 4e-16 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTNW 376 LFAITPAGERGMCCK +G +GFPS KRRPVNCNTTHYR NW Sbjct: 13 LFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 78.6 bits (185), Expect = 3e-15 Identities = 38/54 (70%), Positives = 40/54 (74%) Frame = +1 Query: 355 TRGGARYPIRPIVSRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 T GGA PIRPIVSRITIHWP+F TGKTLA L AAH PFASWRNS+E Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQE 85 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 77.4 bits (182), Expect = 7e-15 Identities = 34/47 (72%), Positives = 35/47 (74%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTNW 376 LFAITPAGERGMCCK +G FPS KRRPVNCNTTHYR NW Sbjct: 7 LFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 77.4 bits (182), Expect = 7e-15 Identities = 34/47 (72%), Positives = 35/47 (74%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTNW 376 LFAITPAGERGMCCK +G FPS KRRPVNCNTTHYR NW Sbjct: 21 LFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 76.2 bits (179), Expect = 2e-14 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGKTLALPNL+ AAH PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEE 42 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 76.2 bits (179), Expect = 2e-14 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTN 379 LFAITPAGERGMCCK +G +GFPS KRRPVNCNTTHYR N Sbjct: 52 LFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 74.9 bits (176), Expect = 3e-14 Identities = 33/47 (70%), Positives = 34/47 (72%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTNW 376 LFAITPAGERGMCCK + FPS KRRPVNCNTTHYR NW Sbjct: 15 LFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.1 bits (169), Expect = 2e-13 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGKTLALPNL+ H PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEE 42 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 70.5 bits (165), Expect = 8e-13 Identities = 33/47 (70%), Positives = 34/47 (72%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTNW 376 LFAITPAGERGMCCK + FPS KRRPVNCNTTHYR NW Sbjct: 1854 LFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 70.1 bits (164), Expect = 1e-12 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*-VG*RQGFPSXQRCKRRPVNCNTTHYRTNW 376 LFAITPAGE+G +G +G RQGFPS KRRPVNCNTTHYR NW Sbjct: 55 LFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.3 bits (157), Expect = 7e-12 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGKTLALPNL+ PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEE 42 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.5 bits (155), Expect = 1e-11 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGKTL++ L AAH PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEE 42 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 63.7 bits (148), Expect = 9e-11 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -3 Query: 514 LRYYASWRKGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 LRYYASWRKG VLQR LSWVTPGFSQS TASEL Sbjct: 14 LRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGK + L AAH PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEE 42 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGK + L AAH PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEE 42 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 61.3 bits (142), Expect = 5e-10 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGK + L AAH PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEE 42 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 60.9 bits (141), Expect = 6e-10 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -3 Query: 514 LRYYASWRKGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 LRYYASWRKG VLQ LSWVTPGFSQS TASEL Sbjct: 14 LRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 1e-09 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +1 Query: 379 IRPIVSRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 IRPIVSRITIHWPSF + + L AAH PFASWR+SEE Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEE 63 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.2 bits (132), Expect = 7e-09 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +1 Query: 409 HWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 HWPSF + TGKTL + L AAH PFASWRNSEE Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEE 40 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 57.2 bits (132), Expect = 7e-09 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -3 Query: 514 LRYYASWRKGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 LRYYASWRKG R LSWVTPGFSQS TASEL Sbjct: 74 LRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + KT + L AAH PFASWRNSE+ Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEK 42 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 53.6 bits (123), Expect = 9e-08 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + + + L AAH PFASWRNSEE Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEE 42 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 53.6 bits (123), Expect = 9e-08 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 379 IRPIVSRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFA 495 +RP+VSRITIHW SF + TGKTLALPNL+ H P + Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIAL-QHIPLS 70 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 440 GKPWRYPT**PLQHXPLSPAGVIAK 514 GK P LQH PLSPAGVIA+ Sbjct: 53 GKTLALPNLIALQHIPLSPAGVIAE 77 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 53.2 bits (122), Expect = 1e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -1 Query: 492 ERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTN 379 ERGMCCK +G F S KRRPVNCNTTHYR N Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 491 KGXCAAKVIKLGNARVFPVXNVVK 420 +G C K IKLGNA VF +VVK Sbjct: 4 RGMCC-KAIKLGNASVFRSHDVVK 26 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 52.8 bits (121), Expect = 2e-07 Identities = 33/54 (61%), Positives = 33/54 (61%) Frame = +1 Query: 355 TRGGARYPIRPIVSRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 T GGA PIRPIVS ITIHWPSF G T AH PFASWRNSEE Sbjct: 36 TVGGA--PIRPIVSHITIHWPSF---YNGVT----------AHPPFASWRNSEE 74 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 52.4 bits (120), Expect = 2e-07 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCNTTHYRTNW 376 + A TP+G++ M + + FPS KRRPVNCNTTHYR NW Sbjct: 13 VLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 52.0 bits (119), Expect = 3e-07 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +1 Query: 409 HWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 HWPSF TGKTLALPNL+ FASWRNS+E Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQE 40 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.6 bits (118), Expect = 4e-07 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXP-FASWRNSEE 516 SRITIHWPSF + TGKTLALPNL H P +AS SEE Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDL-RHIPLYASCTTSEE 42 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 51.2 bits (117), Expect = 5e-07 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 Query: 453 RQGFPSXQRCKRRPVNCNTTHYRTNW 376 R GFPS KRRPVNCNTTHYR NW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 51.2 bits (117), Expect = 5e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +1 Query: 385 PIVSRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFA 495 P +SRITIHWPSF + TGKTLALPNL+ H P + Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLS 112 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 50.4 bits (115), Expect = 9e-07 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = +1 Query: 391 VSRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFASWRNSEE 516 +SRITIHWPS + + L AAH PFASWRNSEE Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 318 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 50.4 bits (115), Expect = 9e-07 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFA-SWRNSEE 516 SRITIHWPSF + TGKTLALPNL+ H P + + NSEE Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVNSEE 42 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -1 Query: 447 GFPSXQRCKRRPVNCNTTHYRTNW 376 GFPS KRRPVNCNTTHYR NW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -1 Query: 447 GFPSXQRCKRRPVNCNTTHYRTNW 376 GFPS KRRPVNCNTTHYR NW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 Score = 33.5 bits (73), Expect = 0.11 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -2 Query: 515 SSLLRQLAKGXCAAKVIKLGNARVFPVXNVVK 420 SSLLRQLAKG CAA+ + G FP +VVK Sbjct: 606 SSLLRQLAKGGCAARRLSWG----FPSHDVVK 633 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -1 Query: 447 GFPSXQRCKRRPVNCNTTHYRTNW 376 GFPS KRRPVNCNTTHYR NW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 Score = 31.1 bits (67), Expect = 0.56 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = -2 Query: 515 SSLLRQLAKGXCAAKVIKLGNARVFPVXNVVK 420 SSLLRQLAKG CAA+ + FP +VVK Sbjct: 35 SSLLRQLAKGGCAARRLSWVTPG-FPSHDVVK 65 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -1 Query: 447 GFPSXQRCKRRPVNCNTTHYRTNW 376 GFPS KRRPVNCNTTHYR NW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 Score = 33.5 bits (73), Expect = 0.11 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -2 Query: 515 SSLLRQLAKGXCAAKVIKLGNARVFPVXNVVK 420 SSLLRQLAKG CAA+ + G FP +VVK Sbjct: 49 SSLLRQLAKGGCAARRLSWG----FPSHDVVK 76 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -1 Query: 447 GFPSXQRCKRRPVNCNTTHYRTNW 376 GFPS KRRPVNCNTTHYR NW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 Score = 33.5 bits (73), Expect = 0.11 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -2 Query: 515 SSLLRQLAKGXCAAKVIKLGNARVFPVXNVVK 420 SSLLRQLAKG CAA+ + G FP +VVK Sbjct: 49 SSLLRQLAKGGCAARRLSWG----FPSHDVVK 76 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 48.4 bits (110), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -3 Query: 514 LRYYASWRKGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 LRYYASWRKG LS TPGFSQS TASEL Sbjct: 43 LRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 48.4 bits (110), Expect = 3e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGKTLALPNLMTFAAHXPFA 495 SRITIHWPSF + TGKTLALPNL+ H P + Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLS 34 Score = 31.9 bits (69), Expect = 0.32 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +2 Query: 440 GKPWRYPT**PLQHXPLSPAGVIAK 514 GK P LQH PLSPAGVIAK Sbjct: 17 GKTLALPNLIALQHIPLSPAGVIAK 41 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 45.2 bits (102), Expect = 3e-05 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 394 SRITIHWPSFTTLXTGK-TLALPNLMTFAAHXPFASWRNSEE 516 SRITIHWPSF + TGK T P+L ASWRNSEE Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEE 43 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 44.8 bits (101), Expect = 4e-05 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +1 Query: 421 FTTLXTGKTLALPNLMTFAAHXPFASWRNS 510 FTTL TGKTLALPNL+ FASWRNS Sbjct: 59 FTTLVTGKTLALPNLIALQHIPHFASWRNS 88 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 44.8 bits (101), Expect = 4e-05 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +1 Query: 409 HWPSFTTLXTGKTLALPNLMTFAAHXPFA-SWRNSEE 516 HWPSF + TGKTLALPNL+ H P + + RNSEE Sbjct: 5 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGRNSEE 40 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 41.9 bits (94), Expect = 3e-04 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 423 KRRPVNCNTTHYRTNW 376 KRRPVNCNTTHYR NW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 41.9 bits (94), Expect = 3e-04 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 423 KRRPVNCNTTHYRTNW 376 KRRPVNCNTTHYR NW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 41.5 bits (93), Expect = 4e-04 Identities = 22/51 (43%), Positives = 25/51 (49%) Frame = +3 Query: 339 KKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 K K+ S+G P LAV DWENPGVTQLN L + PF Sbjct: 1166 KAGKRRSQGKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 1216 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 1207 LNRLAAHPPFASWRNSEE 1224 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 515 SSLLRQLAKGXCAAKVIKLG 456 SSLLRQLAKG CAA+ + G Sbjct: 421 SSLLRQLAKGGCAARRLSWG 440 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 40.7 bits (91), Expect = 7e-04 Identities = 22/48 (45%), Positives = 24/48 (50%) Frame = +3 Query: 348 KKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 K N+R G P LAV DWENPGVTQLN L + PF Sbjct: 80 KSNARAGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 126 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 117 LNRLAAHPPFASWRNSEE 134 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAVF DWENPGVTQLN L + PF Sbjct: 65 LAVFLQRRDWENPGVTQLNRLAAHPPF 91 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 82 LNRLAAHPPFASWRNSEE 99 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAVF DWENPGVTQLN L + PF Sbjct: 8 LAVFLQRRDWENPGVTQLNRLAAHPPF 34 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 25 LNRLAAHPPFASWRNSEE 42 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 40.7 bits (91), Expect = 7e-04 Identities = 22/50 (44%), Positives = 27/50 (54%) Frame = +3 Query: 342 KKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 K+K ++RG P+ LAV DWENPGVTQLN L + PF Sbjct: 34 KRKLSNRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 81 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 72 LNRLAAHPPFASWRNSEE 89 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +1 Query: 436 TGKTLALPNLMTFAAHXPFASWRNSEE 516 TGKT + L AAH PFASWRNSEE Sbjct: 16 TGKTPGVTQLNRLAAHPPFASWRNSEE 42 Score = 34.3 bits (75), Expect = 0.060 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV YNV + PGVTQLN L + PF Sbjct: 8 LAVVYNVVTGKTPGVTQLNRLAAHPPF 34 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/50 (44%), Positives = 25/50 (50%) Frame = +3 Query: 342 KKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 K+ N RG P+ LAV DWENPGVTQLN L + PF Sbjct: 508 KESANQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 555 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 546 LNRLAAHPPFASWRNSEE 563 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFP 439 LFAITPAGERGMCCK +G + FP Sbjct: 28 LFAITPAGERGMCCKAIKLGNARVFP 53 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 491 KGXCAAKVIKLGNARVFPV 435 +G C K IKLGNARVFPV Sbjct: 37 RGMCC-KAIKLGNARVFPV 54 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/51 (43%), Positives = 26/51 (50%) Frame = +3 Query: 339 KKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 K K K ++G P+ LAV DWENPGVTQLN L + PF Sbjct: 14 KGKAKGTKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 53 LNRLAAHPPFASWRNSEE 70 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 409 HWPSFTTLXTGKTLALPNLMTFAAHXPFA 495 HWPSF + TGKTLALPNL+ H P + Sbjct: 62 HWPSFYNVVTGKTLALPNLIAL-QHIPLS 89 Score = 31.9 bits (69), Expect = 0.32 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +2 Query: 440 GKPWRYPT**PLQHXPLSPAGVIAK 514 GK P LQH PLSPAGVIAK Sbjct: 72 GKTLALPNLIALQHIPLSPAGVIAK 96 >SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0) Length = 304 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +1 Query: 445 TLALPNLMTFAAHXPFASWRNSEE 516 TL PN++T AAH PFASWRNSEE Sbjct: 225 TLLKPNMVT-AAHPPFASWRNSEE 247 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 409 HWPSFTTLXTGKTLALPNLMTFAAHXPFA 495 HWPSF + TGKTLALPNL+ H P + Sbjct: 57 HWPSFYNVVTGKTLALPNLIAL-QHIPLS 84 Score = 31.9 bits (69), Expect = 0.32 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +2 Query: 440 GKPWRYPT**PLQHXPLSPAGVIAK 514 GK P LQH PLSPAGVIAK Sbjct: 67 GKTLALPNLIALQHIPLSPAGVIAK 91 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 39.1 bits (87), Expect = 0.002 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +3 Query: 336 AKKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 A +++K + P LAV DWENPGVTQLN L + PF Sbjct: 6 ASRREKGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 57 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 48 LNRLAAHPPFASWRNSEE 65 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 39.1 bits (87), Expect = 0.002 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +3 Query: 336 AKKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 A +++K + P LAV DWENPGVTQLN L + PF Sbjct: 6 ASRREKGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 57 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 48 LNRLAAHPPFASWRNSEE 65 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 38.7 bits (86), Expect = 0.003 Identities = 25/56 (44%), Positives = 28/56 (50%), Gaps = 9/56 (16%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKRRPVNCN---------TTHYRTNW 376 LFAITPAGERGMCCK +G P Q + CN T Y+TNW Sbjct: 1963 LFAITPAGERGMCCKAIKLG---RCPVQQNIQTLIPECNVQYSWSNEDTEPYQTNW 2015 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +3 Query: 351 KNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 K SRG P+ LAV DWENPGVTQLN L + PF Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 859 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 850 LNRLAAHPPFASWRNSEE 867 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 38.7 bits (86), Expect = 0.003 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +3 Query: 339 KKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 K+++ N P LAV DWENPGVTQLN L + PF Sbjct: 1449 KEERVNDHRIPAARGIHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 1499 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 1490 LNRLAAHPPFASWRNSEE 1507 >SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAVF DWENPGVTQLN L + PF Sbjct: 16 LAVFLQRRDWENPGVTQLNLLGAHPPF 42 Score = 30.3 bits (65), Expect = 0.98 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AH PF SWRNSEE Sbjct: 33 LNLLGAHPPFTSWRNSEE 50 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*RQGFPSXQRCKR 418 LFAITPAGERGMCCK +G + + S R R Sbjct: 21 LFAITPAGERGMCCKAIKLGTEELYWSFLRVTR 53 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/58 (37%), Positives = 29/58 (50%) Frame = +3 Query: 318 TRPLT*AKKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 T+ L + ++N +G P+ LAV DWENPGVTQLN L + PF Sbjct: 175 TKSLLSSPMHEENPKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 230 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 221 LNRLAAHPPFASWRNSEE 238 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 21 SSLLRQLAKGGCAAR 35 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 241 KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 233 SSLLRQLAKGGCAAR 247 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 901 SSLLRQLAKGGCAAR 915 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 14 SSLLRQLAKGGCAAR 28 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 21 KGGCAARRLSWVTPGFSQSRRCKTTASEL 49 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 13 SSLLRQLAKGGCAAR 27 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 396 KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 388 SSLLRQLAKGGCAAR 402 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 38.3 bits (85), Expect = 0.004 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = +3 Query: 360 RGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 RGG P LAV DWENPGVTQLN L + PF Sbjct: 84 RGGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 126 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 117 LNRLAAHPPFASWRNSEE 134 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 237 SSLLRQLAKGGCAAR 251 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 312 KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 304 SSLLRQLAKGGCAAR 318 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 378 KGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 370 SSLLRQLAKGGCAAR 384 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 70 KGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 62 SSLLRQLAKGGCAAR 76 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 21 SSLLRQLAKGGCAAR 35 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 14 SSLLRQLAKGGCAAR 28 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 14 SSLLRQLAKGGCAAR 28 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 21 SSLLRQLAKGGCAAR 35 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 38.3 bits (85), Expect = 0.004 Identities = 22/57 (38%), Positives = 27/57 (47%) Frame = +3 Query: 321 RPLT*AKKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 RP T A ++ + + P LAV DWENPGVTQLN L + PF Sbjct: 43 RPGTVALREIRRYQKSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 99 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 90 LNRLAAHPPFASWRNSEE 107 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 21 SSLLRQLAKGGCAAR 35 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 52 KGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 44 SSLLRQLAKGGCAAR 58 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 288 KGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 280 SSLLRQLAKGGCAAR 294 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 272 KGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 264 SSLLRQLAKGGCAAR 278 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.004 Identities = 21/49 (42%), Positives = 24/49 (48%) Frame = +3 Query: 345 KKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 +K RG P+ LAV DWENPGVTQLN L + PF Sbjct: 16 RKSRHRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 53 LNRLAAHPPFASWRNSEE 70 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 14 SSLLRQLAKGGCAAR 28 >SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.004 Identities = 27/73 (36%), Positives = 32/73 (43%) Frame = +3 Query: 273 MSMGSSNHLTPGGL*TRPLT*AKKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPG 452 M+ G SN +PG PL + + S P LAV DWENPG Sbjct: 1 MNKGGSNSCSPGD----PLVLERPPPRWSSNSPYSESYYNS-----LAVVLQRRDWENPG 51 Query: 453 VTQLNDLCSTXPF 491 VTQLN L + PF Sbjct: 52 VTQLNRLAAHPPF 64 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 55 LNRLAAHPPFASWRNSEE 72 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 261 KGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 253 SSLLRQLAKGGCAAR 267 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 286 KGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 278 SSLLRQLAKGGCAAR 292 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 97 LAVILQRRDWENPGVTQLNRLAAHPPF 123 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 114 LNRLAAHPPFASWRNSEE 131 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 470 KGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 462 SSLLRQLAKGGCAAR 476 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 516 LFAITPAGERGMCCKGH*VG*R 451 LFAITPAGERGMCCK +G R Sbjct: 21 LFAITPAGERGMCCKAIKLGIR 42 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 139 KGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 131 SSLLRQLAKGGCAAR 145 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 305 KGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 297 SSLLRQLAKGGCAAR 311 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 155 KGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 147 SSLLRQLAKGGCAAR 161 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 21 SSLLRQLAKGGCAAR 35 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 21 SSLLRQLAKGGCAAR 35 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 7 SSLLRQLAKGGCAAR 21 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 214 KGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 206 SSLLRQLAKGGCAAR 220 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 606 KGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 598 SSLLRQLAKGGCAAR 612 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 242 KGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 234 SSLLRQLAKGGCAAR 248 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 520 KGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 512 SSLLRQLAKGGCAAR 526 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 103 KGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 95 SSLLRQLAKGGCAAR 109 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 411 KGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 403 SSLLRQLAKGGCAAR 417 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 7 SSLLRQLAKGGCAAR 21 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 490 KGXVLQRSLSWVTPGFSQSXTL*KTASEL 404 KG R LSWVTPGFSQS TASEL Sbjct: 204 KGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 515 SSLLRQLAKGXCAAK 471 SSLLRQLAKG CAA+ Sbjct: 196 SSLLRQLAKGGCAAR 210 >SB_8442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +3 Query: 339 KKKKKNSRGGPVPXXXXXXXXXXXLAVFYNVXDWENPGVTQLNDLCSTXPF 491 KK+++ R LAV DWENPGVTQLN L + PF Sbjct: 24 KKQRRYERLAATSQLSLCESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 74 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 65 LNRLAAHPPFASWRNSEE 82 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 52 LNRLAAHPPFASWRNSEE 69 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF 88 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 79 LNRLAAHPPFASWRNSEE 96 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPF 70 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 61 LNRLAAHPPFASWRNSEE 78 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 53 LNRLAAHPPFASWRNSEE 70 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF 88 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 79 LNRLAAHPPFASWRNSEE 96 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPF 93 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 84 LNRLAAHPPFASWRNSEE 101 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 55 LNRLAAHPPFASWRNSEE 72 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 75 LNRLAAHPPFASWRNSEE 92 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPF 96 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 87 LNRLAAHPPFASWRNSEE 104 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPF 72 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 63 LNRLAAHPPFASWRNSEE 80 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 52 LNRLAAHPPFASWRNSEE 69 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPF 51 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 42 LNRLAAHPPFASWRNSEE 59 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 67 LNRLAAHPPFASWRNSEE 84 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF 85 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 76 LNRLAAHPPFASWRNSEE 93 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPF 79 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 70 LNRLAAHPPFASWRNSEE 87 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF 95 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 86 LNRLAAHPPFASWRNSEE 103 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 74 LNRLAAHPPFASWRNSEE 91 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF 66 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 57 LNRLAAHPPFASWRNSEE 74 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPF 242 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 233 LNRLAAHPPFASWRNSEE 250 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPF 137 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 128 LNRLAAHPPFASWRNSEE 145 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF 75 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 66 LNRLAAHPPFASWRNSEE 83 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPF 54 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 45 LNRLAAHPPFASWRNSEE 62 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 33 LNRLAAHPPFASWRNSEE 50 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPF 73 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 64 LNRLAAHPPFASWRNSEE 81 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPF 407 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 398 LNRLAAHPPFASWRNSEE 415 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPF 133 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 124 LNRLAAHPPFASWRNSEE 141 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPF 109 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 100 LNRLAAHPPFASWRNSEE 117 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 56 LNRLAAHPPFASWRNSEE 73 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPF 34 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 25 LNRLAAHPPFASWRNSEE 42 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPF 44 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 35 LNRLAAHPPFASWRNSEE 52 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 55 LNRLAAHPPFASWRNSEE 72 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPF 129 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 120 LNRLAAHPPFASWRNSEE 137 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPF 71 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 62 LNRLAAHPPFASWRNSEE 79 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPF 366 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 357 LNRLAAHPPFASWRNSEE 374 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPF 106 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 97 LNRLAAHPPFASWRNSEE 114 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 67 LNRLAAHPPFASWRNSEE 84 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 33 LNRLAAHPPFASWRNSEE 50 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF 85 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 76 LNRLAAHPPFASWRNSEE 93 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 60 LNRLAAHPPFASWRNSEE 77 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPF 160 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 151 LNRLAAHPPFASWRNSEE 168 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPF 89 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 80 LNRLAAHPPFASWRNSEE 97 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 56 LNRLAAHPPFASWRNSEE 73 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPF 169 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 160 LNRLAAHPPFASWRNSEE 177 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 33 LNRLAAHPPFASWRNSEE 50 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPF 86 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 77 LNRLAAHPPFASWRNSEE 94 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 51 LNRLAAHPPFASWRNSEE 68 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPF 99 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 90 LNRLAAHPPFASWRNSEE 107 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPF 93 Score = 30.7 bits (66), Expect = 0.74 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASW NSEE Sbjct: 84 LNRLAAHPPFASWGNSEE 101 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPF 82 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 73 LNRLAAHPPFASWRNSEE 90 >SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) Length = 106 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 516 LFAITPAGERGMCCK 472 LFAITPAGERGMCCK Sbjct: 21 LFAITPAGERGMCCK 35 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF 95 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 86 LNRLAAHPPFASWRNSEE 103 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHPPF 91 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 82 LNRLAAHPPFASWRNSEE 99 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPF 282 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 273 LNRLAAHPPFASWRNSEE 290 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPF 140 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 131 LNRLAAHPPFASWRNSEE 148 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 67 LNRLAAHPPFASWRNSEE 84 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 53 LNRLAAHPPFASWRNSEE 70 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF 63 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 54 LNRLAAHPPFASWRNSEE 71 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPF 127 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 118 LNRLAAHPPFASWRNSEE 135 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPF 140 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 131 LNRLAAHPPFASWRNSEE 148 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 56 LNRLAAHPPFASWRNSEE 73 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF 46 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 37 LNRLAAHPPFASWRNSEE 54 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 75 LNRLAAHPPFASWRNSEE 92 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF 63 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 54 LNRLAAHPPFASWRNSEE 71 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 51 LNRLAAHPPFASWRNSEE 68 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPF 37 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 28 LNRLAAHPPFASWRNSEE 45 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPF 45 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 36 LNRLAAHPPFASWRNSEE 53 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPF 422 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 413 LNRLAAHPPFASWRNSEE 430 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPF 71 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 62 LNRLAAHPPFASWRNSEE 79 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPF 80 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 71 LNRLAAHPPFASWRNSEE 88 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 53 LNRLAAHPPFASWRNSEE 70 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) Length = 1283 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 516 LFAITPAGERGMCCK 472 LFAITPAGERGMCCK Sbjct: 28 LFAITPAGERGMCCK 42 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPF 145 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 136 LNRLAAHPPFASWRNSEE 153 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPF 81 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 72 LNRLAAHPPFASWRNSEE 89 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPF 91 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 82 LNRLAAHPPFASWRNSEE 99 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPF 94 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 85 LNRLAAHPPFASWRNSEE 102 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPF 440 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 431 LNRLAAHPPFASWRNSEE 448 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPF 137 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 128 LNRLAAHPPFASWRNSEE 145 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPF 93 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 84 LNRLAAHPPFASWRNSEE 101 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPF 82 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 73 LNRLAAHPPFASWRNSEE 90 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPF 72 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 63 LNRLAAHPPFASWRNSEE 80 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF 75 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRN+E+ Sbjct: 66 LNRLAAHPPFASWRNNEK 83 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPF 187 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 178 LNRLAAHPPFASWRNSEE 195 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPF 91 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 82 LNRLAAHPPFASWRNSEE 99 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPF 78 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 69 LNRLAAHPPFASWRNSEE 86 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPF 114 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 105 LNRLAAHPPFASWRNSEE 122 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF 63 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 54 LNRLAAHPPFASWRNSEE 71 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPF 89 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 80 LNRLAAHPPFASWRNSEE 97 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPF 68 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 59 LNRLAAHPPFASWRNSEE 76 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPF 211 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 202 LNRLAAHPPFASWRNSEE 219 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 51 LNRLAAHPPFASWRNSEE 68 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 516 LFAITPAGERGMCCK 472 LFAITPAGERGMCCK Sbjct: 60 LFAITPAGERGMCCK 74 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF 66 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 57 LNRLAAHPPFASWRNSEE 74 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPF 80 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 71 LNRLAAHPPFASWRNSEE 88 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPF 77 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 68 LNRLAAHPPFASWRNSEE 85 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 51 LNRLAAHPPFASWRNSEE 68 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 52 LNRLAAHPPFASWRNSEE 69 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF 75 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 66 LNRLAAHPPFASWRNSEE 83 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 56 LNRLAAHPPFASWRNSEE 73 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPF 158 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 149 LNRLAAHPPFASWRNSEE 166 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPF 67 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 58 LNRLAAHPPFASWRNSEE 75 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPF 110 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 101 LNRLAAHPPFASWRNSEE 118 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPF 48 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 39 LNRLAAHPPFASWRNSEE 56 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPF 179 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 170 LNRLAAHPPFASWRNSEE 187 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPF 366 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 357 LNRLAAHPPFASWRNSEE 374 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 74 LNRLAAHPPFASWRNSEE 91 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPF 47 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 38 LNRLAAHPPFASWRNSEE 55 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPF 135 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 126 LNRLAAHPPFASWRNSEE 143 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 46 LNRLAAHPPFASWRNSEE 63 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPF 112 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 103 LNRLAAHPPFASWRNSEE 120 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 53 LNRLAAHPPFASWRNSEE 70 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPF 86 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 77 LNRLAAHPPFASWRNSEE 94 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPF 320 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 311 LNRLAAHPPFASWRNSEE 328 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 74 LNRLAAHPPFASWRNSEE 91 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 75 LNRLAAHPPFASWRNSEE 92 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 33 LNRLAAHPPFASWRNSEE 50 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 53 LNRLAAHPPFASWRNSEE 70 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPF 437 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 428 LNRLAAHPPFASWRNSEE 445 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPF 121 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 112 LNRLAAHPPFASWRNSEE 129 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPF 77 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 68 LNRLAAHPPFASWRNSEE 85 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 60 LNRLAAHPPFASWRNSEE 77 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 411 LAVFYNVXDWENPGVTQLNDLCSTXPF 491 LAV DWENPGVTQLN L + PF Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPF 119 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 463 LMTFAAHXPFASWRNSEE 516 L AAH PFASWRNSEE Sbjct: 110 LNRLAAHPPFASWRNSEE 127 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,033,019 Number of Sequences: 59808 Number of extensions: 350883 Number of successful extensions: 7509 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7485 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -