BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30372 (460 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0545 - 4756266-4757510 31 0.45 03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711,550... 27 5.5 >05_01_0545 - 4756266-4757510 Length = 414 Score = 31.1 bits (67), Expect = 0.45 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 358 CKPS**YLRWRRQCS*VYRTSPR*CASFQ-QLYVPAP 251 C P+ Y R RQC+ Y P CA+FQ + +VP+P Sbjct: 346 CLPNRPYQRTPRQCAAFYAAPPVDCAAFQCKPFVPSP 382 >03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711, 5500940-5501029,5501147-5501464 Length = 566 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 260 NVKLLKGGASSRRGAVNLRTLTTPT 334 N K KGGAS+ + A + RT T PT Sbjct: 504 NGKAKKGGASTPKKAAHRRTTTVPT 528 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,311,328 Number of Sequences: 37544 Number of extensions: 103687 Number of successful extensions: 211 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 211 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -