BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30368 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 24 0.92 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.7 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 4.9 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.8 bits (49), Expect = 0.92 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 249 PNTIGSRNGTGICPCICRLASGTWRLVI 332 PN I NGTG+ RLA+G LV+ Sbjct: 161 PNNIILGNGTGVQLVPTRLANGDIALVL 188 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.7 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +3 Query: 312 GTWRLVIL*RSANADLCPKQLDSMF*KFQRARARRSLSKNFNKL 443 GT+ +I + DLC K +D M R+R + + KL Sbjct: 1308 GTFSQIITKTQLDFDLCSKPIDEMTVDELRSRDPIKIVADLQKL 1351 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.7 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +3 Query: 312 GTWRLVIL*RSANADLCPKQLDSMF*KFQRARARRSLSKNFNKL 443 GT+ +I + DLC K +D M R+R + + KL Sbjct: 1308 GTFSQIITKTQLDFDLCSKPIDEMTVDELRSRDPIKIVADLQKL 1351 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 306 QGDKCTDIFLCRFSNL 259 +GD C D+ C S L Sbjct: 55 EGDNCRDVIQCTSSGL 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,650 Number of Sequences: 336 Number of extensions: 2352 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -