BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30368 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 196 3e-52 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 2.6 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 196 bits (479), Expect = 3e-52 Identities = 91/130 (70%), Positives = 109/130 (83%) Frame = +2 Query: 2 FQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILT 181 FQKQ + LNRK ++K +R H ++GLGFKTP+EAI GTYIDKKCPFTG++SIRGRILT Sbjct: 10 FQKQLGINLNRKNVSRKKGLRMHHSIGLGFKTPKEAITGTYIDKKCPFTGHISIRGRILT 69 Query: 182 GVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPL 361 GVV+K + + IRRDYL ++ KY+ FEKR+RNM +HLSPCFRDVE GDIVT+GECRPL Sbjct: 70 GVVRKCIV--LLYIRRDYLQFIRKYDTFEKRNRNMRLHLSPCFRDVEAGDIVTLGECRPL 127 Query: 362 SKTVRFNVLK 391 SKTVRFNVLK Sbjct: 128 SKTVRFNVLK 137 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 181 GEDAAADRNVTSEGTLLVNVGT 116 GED D+ S+GTLL +GT Sbjct: 1268 GEDDTGDKKTDSDGTLL-EIGT 1288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,354 Number of Sequences: 2352 Number of extensions: 9896 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -