BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30365 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / po... 53 1e-07 At5g37500.1 68418.m04516 guard cell outward rectifying K+ channe... 48 3e-06 At2g26650.1 68415.m03197 potassium channel protein 1 (AKT1) iden... 42 2e-04 At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel... 37 0.007 At5g53130.1 68418.m06604 cyclic nucleotide-regulated ion channel... 35 0.037 At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT... 35 0.037 At4g32650.2 68417.m04648 inward rectifying potassium channel, pu... 34 0.049 At4g32650.1 68417.m04647 inward rectifying potassium channel, pu... 34 0.049 At5g14870.1 68418.m01744 cyclic nucleotide-regulated ion channel... 33 0.15 At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel... 32 0.20 At1g31150.1 68414.m03811 expressed protein EST gb|Z33866 comes f... 32 0.26 At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel... 31 0.46 At2g40475.1 68415.m04995 expressed protein 31 0.46 At1g01710.1 68414.m00089 acyl-CoA thioesterase family protein co... 31 0.46 At1g19780.1 68414.m02473 cyclic nucleotide-regulated ion channel... 31 0.61 At1g15990.1 68414.m01918 cyclic nucleotide-regulated ion channel... 31 0.61 At1g01340.1 68414.m00049 cyclic nucleotide-regulated ion channel... 30 0.80 At2g28690.1 68415.m03487 expressed protein 30 1.1 At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)... 29 1.4 At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)... 29 1.9 At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)... 29 1.9 At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)... 29 1.9 At4g00510.1 68417.m00070 cyclic nucleotide-binding domain-contai... 29 1.9 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 1.9 At1g77460.1 68414.m09020 C2 domain-containing protein / armadill... 29 1.9 At3g48010.1 68416.m05234 cyclic nucleotide-regulated ion channel... 29 2.5 At2g19440.1 68415.m02269 glycosyl hydrolase family 17 protein si... 28 3.2 At5g40590.1 68418.m04926 DC1 domain-containing protein predicted... 28 4.3 At4g33480.1 68417.m04755 expressed protein 27 5.7 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 27 5.7 At1g51915.1 68414.m05852 cryptdin protein-related contains weak ... 27 5.7 At1g08400.1 68414.m00929 chromosome structural maintenance prote... 27 5.7 At5g18220.1 68418.m02138 glycosyl hydrolase family 17 protein si... 27 7.5 At2g17740.1 68415.m02055 DC1 domain-containing protein 27 7.5 At1g64760.1 68414.m07343 glycosyl hydrolase family 17 protein si... 27 7.5 At4g29050.1 68417.m04155 lectin protein kinase family protein co... 27 9.9 At3g04010.1 68416.m00422 glycosyl hydrolase family 17 protein si... 27 9.9 At2g45480.1 68415.m05656 expressed protein 27 9.9 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 27 9.9 At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-rel... 27 9.9 >At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / potassium channel protein identical to SKOR [Arabidopsis thaliana] gi|3810676|emb|CAA11280; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 828 Score = 52.8 bits (121), Expect = 1e-07 Identities = 25/90 (27%), Positives = 50/90 (55%) Frame = +1 Query: 238 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 417 + + LFR ++ + Q++ + E+ PGE ++ QG D Y + +GV + + D Sbjct: 398 IEKVPLFRGCSSEFINQIVIRLHEEFFLPGEVIMEQGSVVDQLYFVCHGVLEEIGITKDG 457 Query: 418 VEKVVHTYEGSGSFGELALMYNMPRAASVR 507 E++V + SFGE++++ N+P+ +VR Sbjct: 458 SEEIVAVLQPDHSFGEISILCNIPQPYTVR 487 >At5g37500.1 68418.m04516 guard cell outward rectifying K+ channel (GORK) identical to guard cell outward rectifying K+ channel [Arabidopsis thaliana] gi|11414742|emb|CAC17380; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 820 Score = 48.4 bits (110), Expect = 3e-06 Identities = 24/90 (26%), Positives = 49/90 (54%) Frame = +1 Query: 238 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 417 ++ + LF+ + + Q++ + E+ PGE + QG+ D+ Y + G+ + LVT D Sbjct: 381 IKKVPLFKGCSTEFINQIVIRLHEEYFLPGEVITEQGNVVDHLYFVCEGLLEALVTKTDG 440 Query: 418 VEKVVHTYEGSGSFGELALMYNMPRAASVR 507 E+ V SFG+++++ N+ + +VR Sbjct: 441 SEESVTLLGPHTSFGDISIICNISQPFTVR 470 >At2g26650.1 68415.m03197 potassium channel protein 1 (AKT1) identical to AKT1 [Arabidopsis thaliana] gi|563112|gb|AAA96810; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563 Length = 857 Score = 42.3 bits (95), Expect = 2e-04 Identities = 25/89 (28%), Positives = 43/89 (48%) Frame = +1 Query: 247 ILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEK 426 + LFR + + Q++ M + P E VI Q + +FY++ NG D LV D E Sbjct: 370 VYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTAD-LVDVDTGTES 428 Query: 427 VVHTYEGSGSFGELALMYNMPRAASVRAQ 513 +V + GE+ ++ P+ +VR + Sbjct: 429 IVREVKAGDIIGEIGVLCYRPQLFTVRTK 457 >At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel, putative (CNGC14) similar to cyclic nucleotide and calmodulin-regulated ion channel (GI:4581205) [Arabidopsis thaliana] Length = 726 Score = 37.1 bits (82), Expect = 0.007 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +1 Query: 202 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 381 + D QR + VR + LF +D Q + + + + S G Y++R+GD I Sbjct: 464 RRDIQRHLCLDLVRRVPLFAQMDDQLLDAICERLASSLSTQGNYIVREGDPVTEMLFIIR 523 Query: 382 GVFDVLVTGDDR 417 G + T R Sbjct: 524 GKLESSTTNGGR 535 >At5g53130.1 68418.m06604 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC1) almost identical to cyclic nucleotide-regulated ion channel 1 pir:T51354, GI:11357236 from [Arabidopsis thaliana] Length = 716 Score = 34.7 bits (76), Expect = 0.037 Identities = 29/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%) Frame = +1 Query: 145 ETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEP 324 ET +E++ P + + LA +R + +F +D Q + + D + Sbjct: 451 ETRGVDEENLLSNLPKDLRRDIKRHLCLALLMR-VPMFEKMDEQLLDALCDRLQPVLYTE 509 Query: 325 GEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSF-GELALMYNM-PRAA 498 Y++R+GD D I G + T R + Y G+G F GE L + + P ++ Sbjct: 510 ESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFLNSEYLGAGDFCGEELLTWALDPHSS 569 Query: 499 S 501 S Sbjct: 570 S 570 >At4g22200.1 68417.m03209 potassium channel protein 2 (AKT2) (AKT3) identical to potassium channel [Arabidopsis thaliana] gi|1100898|gb|AAA97865; Note: also identical to AKT3 [Arabidopsis thaliana] gi|1172218|gb|AAA96153, which is a truncated version of AKT2, PMID:10852932; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563; identical to cDNA inward-rectifying K+ channel (AKT3) GI:1172219 Length = 802 Score = 34.7 bits (76), Expect = 0.037 Identities = 21/94 (22%), Positives = 48/94 (51%) Frame = +1 Query: 235 AVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDD 414 +V + LF+ + + + ++ M + P E VI Q + D+ Y+I +G +++ + + Sbjct: 388 SVEKVYLFKGVSREILLLLVSKMKAEYIPPREDVIMQNEAPDDVYIIVSGEVEIIDSEME 447 Query: 415 RVEKVVHTYEGSGSFGELALMYNMPRAASVRAQT 516 R E V+ T FGE+ + P++ + + ++ Sbjct: 448 R-ESVLGTLRCGDIFGEVGALCCRPQSYTFQTKS 480 >At4g32650.2 68417.m04648 inward rectifying potassium channel, putative (KAT3) (AKT4) (KC1) identical to K+ inward rectifying channel protein KC1 [Arabidopsis thaliana] gi|4090537|gb|AAC98810; similar to (KAT1) K+ channel [Arabidopsis thaliana] gi|1165000|emb|CAA63601; Shaker-type channel (1P/6TM), PMID:11500563 Length = 597 Score = 34.3 bits (75), Expect = 0.049 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = +1 Query: 253 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVV 432 LF+ + Q++ + + P +I Q + +FYVI +G D++ + V + V Sbjct: 406 LFKGFPEGLLVQLVSQIQAEYFPPKMEIILQNEIPTDFYVIVSGGVDIIAS--KGVSEQV 463 Query: 433 HTYEGSGSF-GELALMYNMPRAASVRAQ 513 G GS GE+ +++N+P+ +VR + Sbjct: 464 LAKLGPGSMAGEIGVVFNIPQPFTVRTR 491 >At4g32650.1 68417.m04647 inward rectifying potassium channel, putative (KAT3) (AKT4) (KC1) identical to K+ inward rectifying channel protein KC1 [Arabidopsis thaliana] gi|4090537|gb|AAC98810; similar to (KAT1) K+ channel [Arabidopsis thaliana] gi|1165000|emb|CAA63601; Shaker-type channel (1P/6TM), PMID:11500563 Length = 662 Score = 34.3 bits (75), Expect = 0.049 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = +1 Query: 253 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVV 432 LF+ + Q++ + + P +I Q + +FYVI +G D++ + V + V Sbjct: 406 LFKGFPEGLLVQLVSQIQAEYFPPKMEIILQNEIPTDFYVIVSGGVDIIAS--KGVSEQV 463 Query: 433 HTYEGSGSF-GELALMYNMPRAASVRAQ 513 G GS GE+ +++N+P+ +VR + Sbjct: 464 LAKLGPGSMAGEIGVVFNIPQPFTVRTR 491 >At5g14870.1 68418.m01744 cyclic nucleotide-regulated ion channel, putative (CNGC18) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 706 Score = 32.7 bits (71), Expect = 0.15 Identities = 27/127 (21%), Positives = 50/127 (39%), Gaps = 4/127 (3%) Frame = +1 Query: 49 EVYKIVRLEDEEYFVKK--PPVARFNNRR--KSVFAETYDPEEDDSDEGAPAVFPKSDAQ 216 E +++ R + EE+ + PP + RR + + T +E+ P + + Q Sbjct: 378 EEWRVKRRDTEEWMRHRQLPPELQERVRRFVQYKWLATRGVDEESILHSLPTDL-RREIQ 436 Query: 217 RARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDV 396 R VR + F +D Q + + + S G Y+ R+GD + + G + Sbjct: 437 RHLCLSLVRRVPFFSQMDDQLLDAICGCLVSSLSTAGTYIFREGDPVNEMLFVIRGQIES 496 Query: 397 LVTGDDR 417 T R Sbjct: 497 STTNGGR 503 >At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel, putative (CNGC15) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 678 Score = 32.3 bits (70), Expect = 0.20 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 2/99 (2%) Frame = +1 Query: 202 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 381 + D +R + VR + LF +D + + + + + G +++R+GD + I Sbjct: 454 RRDIKRHLCFDLVRRVPLFDQMDERMLDAICERLKPALCTEGTFLVREGDPVNEMLFIIR 513 Query: 382 GVFDVLVTGDDRVEKVVHTYEGSGSF-GELALMYNM-PR 492 G D T R G G F GE L + + PR Sbjct: 514 GHLDSYTTNGGRTGFFNSCLIGPGDFCGEELLTWALDPR 552 >At1g31150.1 68414.m03811 expressed protein EST gb|Z33866 comes from this gene Length = 673 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 309 FEHRIQNLLHLLRV-KRTEQQYAPDRLSETGSLCVR 205 FEH++++ LH+ R K+ +QQ D+L E +C R Sbjct: 607 FEHQLESSLHIARAHKQEQQQQQTDKLKENLMVCQR 642 >At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel, putative (CNGC17) similar to cyclic nucleotide and calmodulin-regulated ion channel cngc5 GI:4581205 from [Arabidopsis thaliana] Length = 720 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 202 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGD 351 + D QR + VR + F +D Q + + + + G Y++R+GD Sbjct: 464 RRDIQRHLCLDLVRRVPFFSQMDDQLLDAICERLVSSLCTEGTYLVREGD 513 >At2g40475.1 68415.m04995 expressed protein Length = 193 Score = 31.1 bits (67), Expect = 0.46 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = -2 Query: 446 PSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRTCCICCAS 267 PS+ W++ S+ SS +S P + + C +Y D ++S C Sbjct: 104 PSFSWSSASSSSSSSYSSSSPPSKVEHRPRKCYSCSRSYVKEDDEEEIVSSSPTSTLCYK 163 Query: 266 RERNSSMPRTASARRALCA 210 R +SSM S +RALC+ Sbjct: 164 RGFSSSM---GSMKRALCS 179 >At1g01710.1 68414.m00089 acyl-CoA thioesterase family protein contains Pfam profiles: PF02551 acyl-CoA thioesterase, PF00027 cyclic nucleotide-binding domain Length = 427 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = +1 Query: 226 LAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVT 405 + E + + L + L + ++++ + KR G+YV+R+ D Y I G + V+ Sbjct: 6 VVEFLGNVPLLQKLPSSSLKKIAQVVVPKRYGKGDYVVREDQTWDGCYFILQG--EAQVS 63 Query: 406 GDD 414 G D Sbjct: 64 GPD 66 >At1g19780.1 68414.m02473 cyclic nucleotide-regulated ion channel, putative (CNGC8) similar to cyclic nucleotide and calmodulin-regulated ion channel GI:4581207 from (Arabidopsis thaliana) Length = 728 Score = 30.7 bits (66), Expect = 0.61 Identities = 27/127 (21%), Positives = 53/127 (41%), Gaps = 4/127 (3%) Frame = +1 Query: 49 EVYKIVRLEDEEYFVKK--PPVARFNNRRKSVFA--ETYDPEEDDSDEGAPAVFPKSDAQ 216 E +I R + E++ + P R RR + ET +E++ + P + D + Sbjct: 412 EEMRIKRRDSEQWMHHRSLPQNLRERVRRYDQYKWLETRGVDEENIVQSLPKDL-RRDIK 470 Query: 217 RARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDV 396 R VR + LF ++D + + + + + Y++R+GD + I G + Sbjct: 471 RHLCLNLVRRVPLFANMDERLLDAICERLKPSLYTESTYIVREGDPVNEMLFIIRGRLES 530 Query: 397 LVTGDDR 417 + T R Sbjct: 531 VTTDGGR 537 >At1g15990.1 68414.m01918 cyclic nucleotide-regulated ion channel, putative (CNGC7) similar to cyclic nucleotide and calmodulin-regulated ion channel protein GI:4581207 from [Arabidopsis thaliana] Length = 709 Score = 30.7 bits (66), Expect = 0.61 Identities = 27/127 (21%), Positives = 53/127 (41%), Gaps = 4/127 (3%) Frame = +1 Query: 49 EVYKIVRLEDEEYFVKK--PPVARFNNRRKSVFA--ETYDPEEDDSDEGAPAVFPKSDAQ 216 E +I R + E++ + P R RR + ET +E++ + P + D + Sbjct: 402 EEMRIKRRDSEQWMHHRSLPQNLRERVRRYDQYKWLETRGVDEENIVQSLPKDL-RRDIK 460 Query: 217 RARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDV 396 R VR + LF ++D + + + + + Y++R+GD + I G + Sbjct: 461 RHLCLNLVRRVPLFANMDERLLDAICERLKPSLFTESTYIVREGDPVNEMMFIIRGRLES 520 Query: 397 LVTGDDR 417 + T R Sbjct: 521 VTTDGGR 527 >At1g01340.1 68414.m00049 cyclic nucleotide-regulated ion channel (CNGC10) (ACBK1) almost identical to CaM-regulated potassium ion channel (ACBK1) GI:8515883 from [Arabidopsis thaliana]; contains Pfam domain, PF00520: Ion transport protein Length = 706 Score = 30.3 bits (65), Expect = 0.80 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 1/89 (1%) Frame = +1 Query: 145 ETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEP 324 ET EE+ P + D +R + ++ + LF +D Q + V D + Sbjct: 433 ETRGVEEETLLRNLPKDL-RRDIKRHLCLDLLKKVPLFEIMDEQLLDAVCDRLRPVLYTE 491 Query: 325 GEYVIRQGDD-GDNFYVIENGVFDVLVTG 408 YVIR+GD G+ +V+ + G Sbjct: 492 NSYVIREGDPVGEMLFVMRGRLVSATTNG 520 >At2g28690.1 68415.m03487 expressed protein Length = 231 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 312 LFEHRIQNLLHLLRVKRTEQQYAPDRLSE 226 L + ++NLLHLL++ R E+ A D+L + Sbjct: 41 LHQEEVKNLLHLLKLARQERDEAKDQLQK 69 >At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3) Similar to Arabidopsis luminal binding protein (gb|D89342); contains Pfam domain PF00012: dnaK protein Length = 678 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +1 Query: 187 PAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPG--EYVIRQGDDGD 360 PA F + Q + A A+ G+ + R ++ + + +K E Y + G Sbjct: 193 PAYFNDAQRQATKDAGAIAGLNVVRIINEPTGAAIAYGLDKKGGESNILVYDLGGGTFDV 252 Query: 361 NFYVIENGVFDVLVTGDD 414 + I+NGVF+VL T D Sbjct: 253 SILTIDNGVFEVLSTSGD 270 >At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 613 Score = 29.1 bits (62), Expect = 1.9 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 4/124 (3%) Frame = +1 Query: 55 YKIVRLEDEEYFVKKPP-VARFNNRRKSVFAETYDPEE-DDSDEGAPAVFPKSDAQRARL 228 Y V+++D E V P ++ + AE Y ++ D+ PA F + Q + Sbjct: 133 YIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKD 192 Query: 229 AEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYV--IENGVFDVLV 402 A + G+ + R ++ + + +K E V G + V I+NGVF+VL Sbjct: 193 AGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLS 252 Query: 403 TGDD 414 T D Sbjct: 253 TNGD 256 >At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 668 Score = 29.1 bits (62), Expect = 1.9 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 4/124 (3%) Frame = +1 Query: 55 YKIVRLEDEEYFVKKPP-VARFNNRRKSVFAETYDPEE-DDSDEGAPAVFPKSDAQRARL 228 Y V+++D E V P ++ + AE Y ++ D+ PA F + Q + Sbjct: 133 YIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKD 192 Query: 229 AEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYV--IENGVFDVLV 402 A + G+ + R ++ + + +K E V G + V I+NGVF+VL Sbjct: 193 AGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLS 252 Query: 403 TGDD 414 T D Sbjct: 253 TNGD 256 >At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1) SWISS-PROT:Q9LKR3 PMID:8888624 Length = 669 Score = 29.1 bits (62), Expect = 1.9 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 4/124 (3%) Frame = +1 Query: 55 YKIVRLEDEEYFVKKPP-VARFNNRRKSVFAETYDPEE-DDSDEGAPAVFPKSDAQRARL 228 Y V+++D E V P ++ + AE Y ++ D+ PA F + Q + Sbjct: 133 YIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKD 192 Query: 229 AEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYV--IENGVFDVLV 402 A + G+ + R ++ + + +K E V G + V I+NGVF+VL Sbjct: 193 AGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLS 252 Query: 403 TGDD 414 T D Sbjct: 253 TNGD 256 >At4g00510.1 68417.m00070 cyclic nucleotide-binding domain-containing protein contains Pfam profile: PF00027 cyclic nucleotide-binding domain Length = 175 Score = 29.1 bits (62), Expect = 1.9 Identities = 17/87 (19%), Positives = 42/87 (48%), Gaps = 6/87 (6%) Frame = +1 Query: 226 LAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLV- 402 + E + + L + L + ++++ + + K + G+YV+R+ + D Y + G V Sbjct: 6 VVEFLGNVTLLQRLPSSSLKRISEVVVFKGYDRGDYVVRENQNVDGVYFLLQGQVRAQVL 65 Query: 403 --TGDDRVEKVV---HTYEGSGSFGEL 468 G++ ++ + + G G FG++ Sbjct: 66 RSAGEENYQEFPLKRYDFFGHGIFGDV 92 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.1 bits (62), Expect = 1.9 Identities = 20/47 (42%), Positives = 23/47 (48%) Frame = -2 Query: 464 SPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSP 324 SP+ P PS T ST S P K+P T K SPS P L + P Sbjct: 76 SPSTPIPS----TPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVP 118 >At1g77460.1 68414.m09020 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2110 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 462 AKRTGTFVCVDHLFDAVVSGDQDVENAVLD 373 A TF C+ HL A+ SG +DV+ VLD Sbjct: 1899 ASEAATF-CIPHLVGALKSGVEDVQGLVLD 1927 >At3g48010.1 68416.m05234 cyclic nucleotide-regulated ion channel, putative (CNGC16) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 705 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/68 (25%), Positives = 27/68 (39%) Frame = +1 Query: 214 QRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFD 393 QR VR + F +D Q + + + + + YVIR+GD + I G + Sbjct: 444 QRHLCLALVRRVPFFAQMDDQLLDAICERLVPSLNTKDTYVIREGDPVNEMLFIIRGQME 503 Query: 394 VLVTGDDR 417 T R Sbjct: 504 SSTTDGGR 511 >At2g19440.1 68415.m02269 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum]; an isoform contains a non-consensus GA-AG intron Length = 478 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = -1 Query: 216 LCVRLGEHG----RGSFVRIILFGVISLGENGFAPIVKARHWRLF 94 L RLGE+ R +++ + LFG++ AP RHW +F Sbjct: 284 LLPRLGENRGTPLRPTYIEVYLFGLLDEDAKSIAPGEFERHWGIF 328 >At5g40590.1 68418.m04926 DC1 domain-containing protein predicted protein, Arabidopsis thaliana Length = 234 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = -3 Query: 172 NHPLRGHKSRRKR--ICADC 119 NHPLRGHK K IC+ C Sbjct: 13 NHPLRGHKCEAKDEIICSGC 32 >At4g33480.1 68417.m04755 expressed protein Length = 336 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 486 HVVHQGQ-FAKRTGTFVCVDHLFDAVVSGDQDVENAVLDDVEV 361 H+VH G + R G D++FD QDVE + VE+ Sbjct: 221 HLVHSGFCYTARGGFCYTEDNVFDFRTDDGQDVEGLPTEGVEI 263 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -2 Query: 482 LYIRASSPNEPEPSYV-WTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGS 318 L + SSP P PS ++ S SP +S + LSPSSP ++ SP S Sbjct: 61 LSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSS 116 >At1g51915.1 68414.m05852 cryptdin protein-related contains weak similarity to Swiss-Prot:P17533 cryptdin-related protein 1C precursor (CRS1C) [Mus musculus] Length = 67 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 362 LSPSSPCLITYSPGSDLFSNIASRTC--CICCASRERNSSMP 243 LSP PC T + D + + R C C+CCA R + P Sbjct: 20 LSPILPCQATRAH-LDAETRMLRRVCPSCVCCAPAPRGACCP 60 >At1g08400.1 68414.m00929 chromosome structural maintenance protein-related contains weak similarity to RAD50-interacting protein 1 [Homo sapiens] gi|11967435|gb|AAG42101 Length = 804 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = -1 Query: 372 DVEVVAVIALSDYVLAGLGSLFEHRIQNLLHLLRVKRTEQQYAPDRLSETGSLCVRL 202 +V+ A++ + G+ F R++ +L LLR+ E+ LS +G+ C++L Sbjct: 731 EVDAEALLTVLKPYCVRPGAFFP-RVREILRLLRMHEEEKARLRGALSRSGNTCLKL 786 >At5g18220.1 68418.m02138 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 488 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -1 Query: 216 LCVRLGEHGRGSFVRIILFGVISLGENGFAPIVKARHWRLF 94 L G R ++ + LFG I AP RHW +F Sbjct: 295 LAANRGTPMRPGYIEVYLFGFIDEDAKSIAPGNFERHWGIF 335 >At2g17740.1 68415.m02055 DC1 domain-containing protein Length = 248 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -3 Query: 172 NHPLRGHKSR--RKRICADC*SAPLAAFLQ 89 NHPLRGHK++ + IC+ C L A+ + Sbjct: 13 NHPLRGHKAQVEDEIICSGCDLDLLGAYFK 42 >At1g64760.1 68414.m07343 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 481 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 189 RGSFVRIILFGVISLGENGFAPIVKARHWRLF 94 R +++ + LFG++ AP RHW +F Sbjct: 301 RPTYIEVYLFGLLDEDAKSIAPGPFERHWGIF 332 >At4g29050.1 68417.m04155 lectin protein kinase family protein contains Pfam domains, PF00138: Legume lectins alpha domain, PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 669 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 116 LTIGANPFSPRLMTPKRMILTKEPLPC 196 +T G P PR +P M+LT L C Sbjct: 538 ITCGRRPVLPRASSPSEMVLTDWVLDC 564 >At3g04010.1 68416.m00422 glycosyl hydrolase family 17 protein similar to beta-1,3-glucanase GB:S12402 [Nicotiana sp], GB:CAA03908 [Citrus sinensis], GB:S44364 [Lycopersicon esculentum] Length = 491 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -1 Query: 216 LCVRLGEHGRGSFVRIILFGVISLGENGFAPIVKARHWRLF 94 L +G R ++ + LFG I AP RHW +F Sbjct: 300 LANNVGTPMRKGYIEVYLFGFIDEDAKSVAPGNFERHWGIF 340 >At2g45480.1 68415.m05656 expressed protein Length = 429 Score = 26.6 bits (56), Expect = 9.9 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 4/89 (4%) Frame = +2 Query: 59 KLSGWRTKNIL*KSRQWRALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSLRR 238 K S R +I+ +SR+W+ + + F +P ++ + T EP RR Sbjct: 254 KFSSNRKNDIIARSREWKNMNVNGGLFHGIHFSPDTVLQERGCFRLQGVETDNEPGRCRR 313 Query: 239 SGA--YCCS--VLLTRSKCSRFWMRCSKR 313 + + CS VL + C + R K+ Sbjct: 314 TDGKKWRCSKDVLSGQKYCDKHMHRGMKK 342 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 26.6 bits (56), Expect = 9.9 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -1 Query: 438 CVDHLFDAVVSGDQDVENAVLDDV 367 C+ HL A+ SG+Q+ ++ +D + Sbjct: 1912 CIPHLIGALKSGEQEARDSAMDTI 1935 >At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-related similar to BEIGE (GI:3928547) [Rattus norvegicus]; Similar to gb|U70015 lysosomal trafficking regulator from Mus musculus and contains 2 Pfam PF00400 WD-40, G-beta repeats. ESTs gb|T43386 and gb|AA395236 come from this gene Length = 3601 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -1 Query: 453 TGTFVCVDHLFDAVVSGDQDVENAVLDDVEVVAVIALSDYVL 328 +G F C+ H+ A+++ D+ ++ + D+EVV+ + Y++ Sbjct: 188 SGIFCCLIHVLIALLAYDELSKSKITGDLEVVSAEKDAGYIV 229 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,780,026 Number of Sequences: 28952 Number of extensions: 255491 Number of successful extensions: 934 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 932 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -