BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30358 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC009764-1|AAH09764.1| 212|Homo sapiens mitochondrial ribosomal... 42 0.001 AF151876-1|AAD34113.1| 212|Homo sapiens CGI-118 protein protein. 42 0.001 >BC009764-1|AAH09764.1| 212|Homo sapiens mitochondrial ribosomal protein L48 protein. Length = 212 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/77 (24%), Positives = 39/77 (50%) Frame = +2 Query: 281 YDCLNLQLKGYDYAILEACQSQIHRYAEVMGLQVEDCWATPAQQLKVQRFKPGSTALDAE 460 Y LN+ L YD + E+ +H + ++VE+ +A P + ++V + + + + + Sbjct: 88 YGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLD 147 Query: 461 YQLNIYERNVQVVDVPA 511 L +ER VQ+ + A Sbjct: 148 SVLTTHERVVQISGLSA 164 >AF151876-1|AAD34113.1| 212|Homo sapiens CGI-118 protein protein. Length = 212 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/77 (24%), Positives = 39/77 (50%) Frame = +2 Query: 281 YDCLNLQLKGYDYAILEACQSQIHRYAEVMGLQVEDCWATPAQQLKVQRFKPGSTALDAE 460 Y LN+ L YD + E+ +H + ++VE+ +A P + ++V + + + + + Sbjct: 88 YGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLD 147 Query: 461 YQLNIYERNVQVVDVPA 511 L +ER VQ+ + A Sbjct: 148 SVLTTHERVVQISGLSA 164 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,632,880 Number of Sequences: 237096 Number of extensions: 1069681 Number of successful extensions: 1881 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1881 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -