BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30357 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 26 0.66 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 2.6 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 24 3.5 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 24 3.5 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 24 3.5 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 6.1 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 6.1 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 6.1 Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. 23 8.1 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 8.1 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 26.2 bits (55), Expect = 0.66 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = -1 Query: 303 IFESLGCFGAQEVIDGRDGQCWAASVSDSVQLTEDHGWADPDPHHVMRHIRVRHESSYRP 124 +F L ++ D Q + SVQ E+HG PD H++ R + + Y+P Sbjct: 232 VFPKLMAQLQMDIFDSTHVQFFTEMFRQSVQEREEHGIVRPDLIHLLIQAR-KGQLRYQP 290 Query: 123 R 121 + Sbjct: 291 Q 291 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/45 (22%), Positives = 20/45 (44%) Frame = +1 Query: 343 HRARSVVPRAKSLAPLDTIYSYSYGEPIPYRFSNDAYIAKLLVPL 477 + +R VV +T+Y + G + R A + +L+P+ Sbjct: 94 YESRKVVSVVNGWVDFETVYRETSGRALELRLRTKAQVIAILLPI 138 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = -1 Query: 237 AASVSDSVQLTEDHGWADPDPHHVMRHIRVRHESSYRPRCRTVNQFSR 94 A+ + +++ ++ +GW PDP +RH S + ++VN +R Sbjct: 98 ASLLGEAIHDSQPYGWQLPDP-AAIRHDWATLTESVQNHIKSVNWVTR 144 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = -1 Query: 237 AASVSDSVQLTEDHGWADPDPHHVMRHIRVRHESSYRPRCRTVNQFSR 94 A+ + +++ ++ +GW PDP +RH S + ++VN +R Sbjct: 74 ASLLGEAIHDSQPYGWQLPDP-AAIRHDWATLTESVQNHIKSVNWVTR 120 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = -1 Query: 237 AASVSDSVQLTEDHGWADPDPHHVMRHIRVRHESSYRPRCRTVNQFSR 94 A+ + +++ ++ +GW PDP +RH S + ++VN +R Sbjct: 71 ASLLGEAIHDSQPYGWQLPDP-AAIRHDWATLTESVQNHIKSVNWVTR 117 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 216 VQLTEDHGWA 187 V LT DHGWA Sbjct: 320 VALTSDHGWA 329 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 409 SYGEPIPYRFSNDAYIA 459 S+G+P+P+ NDA+ A Sbjct: 185 SFGDPLPWSECNDAWNA 201 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 409 SYGEPIPYRFSNDAYIA 459 S+G+P+P+ NDA+ A Sbjct: 185 SFGDPLPWSECNDAWNA 201 >Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. Length = 124 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 189 ADPDPHHVMRHIRV 148 A+P HH +RH+RV Sbjct: 4 AEPLVHHHLRHLRV 17 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 16 ITRALTMVYESDFYTTRRPYRSTYSVTAEL 105 +TRA V + + + PYR YS + EL Sbjct: 280 MTRACDEVMQRANHLSSNPYRDLYSWSPEL 309 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,142 Number of Sequences: 2352 Number of extensions: 9761 Number of successful extensions: 26 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -