BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30354 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical pr... 28 4.6 U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. 28 4.6 L10986-3|AAA28018.1| 650|Caenorhabditis elegans Abnormal cell m... 27 6.0 L10986-2|AAK84523.2| 667|Caenorhabditis elegans Abnormal cell m... 27 6.0 L10986-1|AAR25648.1| 779|Caenorhabditis elegans Abnormal cell m... 27 6.0 >Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical protein E02H4.1 protein. Length = 664 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 148 AAWLIDEWRNSRVNSVVLERSVLSSFGGQRHCQRQADCQKDTH 20 +AW D + +N + E + LS+ Q+HC+ CQ+D + Sbjct: 501 SAWC-DSTNTTTLNCLTTEGAKLSTKENQKHCKCIQPCQQDQY 542 >U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. Length = 664 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 148 AAWLIDEWRNSRVNSVVLERSVLSSFGGQRHCQRQADCQKDTH 20 +AW D + +N + E + LS+ Q+HC+ CQ+D + Sbjct: 501 SAWC-DSTNTTTLNCLTTEGAKLSTKENQKHCKCIQPCQQDQY 542 >L10986-3|AAA28018.1| 650|Caenorhabditis elegans Abnormal cell migration protein10, isoform b protein. Length = 650 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 64 GRRNWKVHSFPVQPSLLY 117 GR++WK H F ++PS LY Sbjct: 340 GRKSWKKHYFVLRPSGLY 357 >L10986-2|AAK84523.2| 667|Caenorhabditis elegans Abnormal cell migration protein10, isoform a protein. Length = 667 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 64 GRRNWKVHSFPVQPSLLY 117 GR++WK H F ++PS LY Sbjct: 357 GRKSWKKHYFVLRPSGLY 374 >L10986-1|AAR25648.1| 779|Caenorhabditis elegans Abnormal cell migration protein10, isoform c protein. Length = 779 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 64 GRRNWKVHSFPVQPSLLY 117 GR++WK H F ++PS LY Sbjct: 469 GRKSWKKHYFVLRPSGLY 486 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,684,869 Number of Sequences: 27780 Number of extensions: 163314 Number of successful extensions: 568 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -