BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30353 (424 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0590 - 20853040-20853081,20853694-20853918,20854995-208558... 29 2.0 01_05_0080 - 17957276-17957676,17957810-17957921,17958001-179581... 29 2.0 >12_02_0590 - 20853040-20853081,20853694-20853918,20854995-20855886, 20856120-20856122,20856284-20856513 Length = 463 Score = 28.7 bits (61), Expect = 2.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 63 QSLGTGSWTGSTATLECGGRG 1 Q+ G+GSW + L CGG G Sbjct: 2 QATGSGSWVAQASVLGCGGGG 22 >01_05_0080 - 17957276-17957676,17957810-17957921,17958001-17958126, 17958199-17958331,17960069-17960193,17960314-17960409, 17960430-17960621,17960694-17960800,17961318-17961426, 17961538-17961624,17963017-17963103,17964254-17964379 Length = 566 Score = 28.7 bits (61), Expect = 2.0 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 177 PLLNKRVREIQNSSSVKTRSGRTWMNS*RNTSTN-GANSGPRRRMSSNALKRSRPSA 344 PLL R + N+ SVK R ++ R +ST+ + P ++M+++ S SA Sbjct: 420 PLLRSNKRVVTNNPSVKVRLWSIQISDKRKSSTDLSTSQPPLKKMTTDGAMNSMTSA 476 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,680,116 Number of Sequences: 37544 Number of extensions: 176149 Number of successful extensions: 488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -